(data stored in ACNUC7421 zone)

EMBL: CR954246.FTSE

CR954246.FTSE        Location/Qualifiers
FT   CDS             369614..370291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="PSHAa0355"
FT                   /product="cell division protein (ABC transporteur
FT                   superfamily, ATP_binding)"
FT                   /function="1.7 : Cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3025556, 10048040; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85453"
FT                   /db_xref="GOA:Q3IIB3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIB3"
FT                   /protein_id="CAI85453.1"
FT                   /translation="MINFQQVSKTYPGGHRALEKVNFHIKPGELAFLTGHSGAGKSTLL
FT                   KLISLMERPSAGSVFINGIDLNKVNSRQIPYVRRDIGIIFQNHRLLERYTIFDNVALPL
FT                   IIEGTHHKQIAKRVHGALDKVGLIDKIKCHPSMLSGGEQQRVGIARAIVNSPPILLADE
FT                   PTGNLDPELSMEILRLFEEFNNHGTTVLIATHDLGLVARMKYRSLTLKDGRMIQDPLAE
FT                   GAL"
     MINFQQVSKT YPGGHRALEK VNFHIKPGEL AFLTGHSGAG KSTLLKLISL MERPSAGSVF        60
     INGIDLNKVN SRQIPYVRRD IGIIFQNHRL LERYTIFDNV ALPLIIEGTH HKQIAKRVHG       120
     ALDKVGLIDK IKCHPSMLSG GEQQRVGIAR AIVNSPPILL ADEPTGNLDP ELSMEILRLF       180
     EEFNNHGTTV LIATHDLGLV ARMKYRSLTL KDGRMIQDPL AEGAL                       225
//

If you have problems or comments...

PBIL Back to PBIL home page