(data stored in ACNUC7421 zone)

EMBL: CR954246.FTSX

CR954246.FTSX        Location/Qualifiers
FT   CDS             370288..371274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="PSHAa0356"
FT                   /product="cell division protein"
FT                   /function="1.7 : Cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3025556; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85454"
FT                   /db_xref="GOA:Q3IIB2"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIB2"
FT                   /protein_id="CAI85454.1"
FT                   /translation="MSLLFKSRQNSNDKQKKSVFAGGYFFIINIFRQGVHSLGEMWRTP
FT                   LASLMTIAVLGLSLTLPASLYLVVKNVQQVSSGFEEASEISLFVKESMNEQETQTLVKR
FT                   LALYPEVESVTFISKQQALQEFKQVSGFGQALSYLNSNPLPDVVLVIPTSRHRQPNAAK
FT                   VLLTKLESEREVDFGKLDIAWLERLNALLSLLKESVITIALLLLTSVTLIIGNTIRLSI
FT                   MDKKEEIQVMKLVGATNTFIHAPFLWTGIWYGVIGGLFAFICVALMMWWLSTAVSSVAS
FT                   VYQTSFSLIGLTLKEFGSLVLLATSLGFIGSYLSVNRYIKEIEPDKV"
     MSLLFKSRQN SNDKQKKSVF AGGYFFIINI FRQGVHSLGE MWRTPLASLM TIAVLGLSLT        60
     LPASLYLVVK NVQQVSSGFE EASEISLFVK ESMNEQETQT LVKRLALYPE VESVTFISKQ       120
     QALQEFKQVS GFGQALSYLN SNPLPDVVLV IPTSRHRQPN AAKVLLTKLE SEREVDFGKL       180
     DIAWLERLNA LLSLLKESVI TIALLLLTSV TLIIGNTIRL SIMDKKEEIQ VMKLVGATNT       240
     FIHAPFLWTG IWYGVIGGLF AFICVALMMW WLSTAVSSVA SVYQTSFSLI GLTLKEFGSL       300
     VLLATSLGFI GSYLSVNRYI KEIEPDKV                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page