(data stored in ACNUC7421 zone)

EMBL: CR954246.FTSY

CR954246.FTSY        Location/Qualifiers
FT   CDS             367425..369380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="PSHAa0354"
FT                   /product="Cell division transporter substrate-binding
FT                   protein FtsY"
FT                   /function="1.7.2 : Cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3025556, 2161989, 8194520, 15148364"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85452"
FT                   /db_xref="GOA:Q3IIB4"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIB4"
FT                   /protein_id="CAI85452.1"
FT                   /translation="MAKKSKLLSWLGFGKSDKKQQAEQSAQEADNQQQARLAAEKAEAE
FT                   HLEQQRLAAEKAEQEAAEKIAAEQAQREQAEKLAIEKANAELLAKQQADAHALQLEQQQ
FT                   RLAEQEAQMRLEQEKAAAEQAEAERLEQARIVAEQAEAENLEQRKLAAEQAQREQAEKL
FT                   AIEKANAELLAKQQADAHALQLEQQQRLAEQEAQIRLDQEKAAAEKAEAERLEQTRIAA
FT                   EQAEAERLEQTRIAAEQAEAERLEQARIAAEQAEAERAEAERAEAERAEAERLEQVRIA
FT                   AEQAEAEQLEQQRIADEQAEAERLEQQRIAAEQAEAEHLEQQRIADELASEAAQKVEKP
FT                   KKEGFFSRLKKGLLKTRVNIGSGFASIFSGKKIDDDLFEELETQLLTADLGVDTTMKLI
FT                   DRLTDAANRKQLKDGDALYELMKQEMAVMLKTAEQPLVIPADKKPFVILMVGVNGVGKT
FT                   TTIGKLAKQFQSEGKSVMLAAGDTFRAAAVEQLQVWGERNSIPVIAQHTGADSASVIFD
FT                   AFQAAKARNVDVLIADTAGRLQNKDNLMQELEKIARVMKKIDPDAPHEVMLTIDAGTGQ
FT                   NAISQVNLFNQCVGLTGITLSKLDGTAKGGVIFAVADKFNIPIRYIGVGESIDDLRAFK
FT                   SDDFIDALFSQDEDDA"
     MAKKSKLLSW LGFGKSDKKQ QAEQSAQEAD NQQQARLAAE KAEAEHLEQQ RLAAEKAEQE        60
     AAEKIAAEQA QREQAEKLAI EKANAELLAK QQADAHALQL EQQQRLAEQE AQMRLEQEKA       120
     AAEQAEAERL EQARIVAEQA EAENLEQRKL AAEQAQREQA EKLAIEKANA ELLAKQQADA       180
     HALQLEQQQR LAEQEAQIRL DQEKAAAEKA EAERLEQTRI AAEQAEAERL EQTRIAAEQA       240
     EAERLEQARI AAEQAEAERA EAERAEAERA EAERLEQVRI AAEQAEAEQL EQQRIADEQA       300
     EAERLEQQRI AAEQAEAEHL EQQRIADELA SEAAQKVEKP KKEGFFSRLK KGLLKTRVNI       360
     GSGFASIFSG KKIDDDLFEE LETQLLTADL GVDTTMKLID RLTDAANRKQ LKDGDALYEL       420
     MKQEMAVMLK TAEQPLVIPA DKKPFVILMV GVNGVGKTTT IGKLAKQFQS EGKSVMLAAG       480
     DTFRAAAVEQ LQVWGERNSI PVIAQHTGAD SASVIFDAFQ AAKARNVDVL IADTAGRLQN       540
     KDNLMQELEK IARVMKKIDP DAPHEVMLTI DAGTGQNAIS QVNLFNQCVG LTGITLSKLD       600
     GTAKGGVIFA VADKFNIPIR YIGVGESIDD LRAFKSDDFI DALFSQDEDD A                651
//

If you have problems or comments...

PBIL Back to PBIL home page