(data stored in ACNUC7421 zone)

EMBL: CR954246.FUMC

CR954246.FUMC        Location/Qualifiers
FT   CDS             complement(48132..49508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumC"
FT                   /locus_tag="PSHAa0048"
FT                   /product="fumarase C (fumarate hydratase Class II)"
FT                   /function="2.1.2.1 : TCA cycle"
FT                   /EC_number="4.2.1.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9045798, 11133938; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85158"
FT                   /db_xref="GOA:Q3IF10"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF10"
FT                   /protein_id="CAI85158.1"
FT                   /translation="MTQFRTESDSMGELQVPANALYQAQTQRAVNNFAISGLAMPKQFI
FT                   TALAYIKQAAAQSNFELGHLSKTKAKAIEQACQEIIDGSHYEHFPVDIFQTGSGTSSNM
FT                   NANEVIATLASRLGDESIHPNDDVNMGQSSNDVIPTAIALSSAINVVYELLPSLEKLSQ
FT                   HLEHKKAEVGAIVKTGRTHLMDAMPVTFGQTLSAWQTQINHAAAGIRHSLERVCELAQG
FT                   GTAVGTGINADPQFAPLFAKNLSANVGIRFTPSSNFFYNIGSQDAIVALSGQLKVLAVA
FT                   QMKIANDLRWMNSGPLAGLGEIELEALQPGSSIMPGKVNPVIPEAAAMVSAQVIGNDAT
FT                   ITVAGQAGNFELNVMLPVIAYNILQSIELLANSAQALGDKAIASFTVNQLNIDKALAKN
FT                   PILVTALNPVIGYEKAAKIAKQAYKEARPIIDVAEQETDLSRSELEKLLNPSKLTQGGL
FT                   "
     MTQFRTESDS MGELQVPANA LYQAQTQRAV NNFAISGLAM PKQFITALAY IKQAAAQSNF        60
     ELGHLSKTKA KAIEQACQEI IDGSHYEHFP VDIFQTGSGT SSNMNANEVI ATLASRLGDE       120
     SIHPNDDVNM GQSSNDVIPT AIALSSAINV VYELLPSLEK LSQHLEHKKA EVGAIVKTGR       180
     THLMDAMPVT FGQTLSAWQT QINHAAAGIR HSLERVCELA QGGTAVGTGI NADPQFAPLF       240
     AKNLSANVGI RFTPSSNFFY NIGSQDAIVA LSGQLKVLAV AQMKIANDLR WMNSGPLAGL       300
     GEIELEALQP GSSIMPGKVN PVIPEAAAMV SAQVIGNDAT ITVAGQAGNF ELNVMLPVIA       360
     YNILQSIELL ANSAQALGDK AIASFTVNQL NIDKALAKNP ILVTALNPVI GYEKAAKIAK       420
     QAYKEARPII DVAEQETDLS RSELEKLLNP SKLTQGGL                               458
//

If you have problems or comments...

PBIL Back to PBIL home page