(data stored in ACNUC7421 zone)

EMBL: CR954246.FUSA

CR954246.FUSA        Location/Qualifiers
FT   CDS             237804..239918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="PSHAa0226"
FT                   /product="protein chain elongation factor EF-G,
FT                   GTP-binding"
FT                   /function="3.3.4 : Elongation"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3884371, 11294875, 12369843, 12960150; Product type f :
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85329"
FT                   /db_xref="GOA:Q3ILP5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILP5"
FT                   /protein_id="CAI85329.1"
FT                   /translation="MARTTPLERYRNIGICAHVDAGKTTTTERILFYTGLSHKIGETHD
FT                   GAATMDWMEQEQERGITITSAATTCFWKGMDAQFDAHRINIIDTPGHVDFTIEVERSLR
FT                   VLDGAVVVLCASSGVQPQTETVWRQANKYEVPRMIFVNKMDRTGADFFAVVDQVKSRLG
FT                   ATPVPIQLPIGAEDGFKGVIDLIKMKAINWNEADQGMTFTYEAIPAELQELADEWRSHL
FT                   VESAAEATEELMDKYLEGEELSEAEIKEALRQRTLANDIVPMTCGSAFKNKGVQAVLDC
FT                   VVEYMPAPTQVKQIQGILEDGTEEERPADDKAPFAALAFKIATDPFVGTLTFFRVYSGT
FT                   VKQGDAVYNPVKSKRERLGRIVQMHSNSREEIKEVFAGDIAAAIGLKDVTTGETLCDPK
FT                   SIITLERMEFPEPVISVAVEPRTIADQDKMGIALGKLAAEDPSFRVQTDEESGQIIISG
FT                   MGELHLDILVERMKREFSVECNVGKPQVAYREAIRSTVKVEGKFIRQSGGRGQYGHVWL
FT                   KLEPMDITDDEAPIYEFVNETVGGSIPKEYVPAVDKGIQEQMSQGVLAGYPLLGVKATL
FT                   YDGSFHDVDSNEMAFKIAGSLAMKQGALQASPVLLEPVMKVEVLTPEANMGDVVGDLNR
FT                   RRGMIEGMEDALGGLKQINAQVPLSEMFGYATDLRSATQGRASYSMEFLKYAEASKHVA
FT                   ETIISARAVI"
     MARTTPLERY RNIGICAHVD AGKTTTTERI LFYTGLSHKI GETHDGAATM DWMEQEQERG        60
     ITITSAATTC FWKGMDAQFD AHRINIIDTP GHVDFTIEVE RSLRVLDGAV VVLCASSGVQ       120
     PQTETVWRQA NKYEVPRMIF VNKMDRTGAD FFAVVDQVKS RLGATPVPIQ LPIGAEDGFK       180
     GVIDLIKMKA INWNEADQGM TFTYEAIPAE LQELADEWRS HLVESAAEAT EELMDKYLEG       240
     EELSEAEIKE ALRQRTLAND IVPMTCGSAF KNKGVQAVLD CVVEYMPAPT QVKQIQGILE       300
     DGTEEERPAD DKAPFAALAF KIATDPFVGT LTFFRVYSGT VKQGDAVYNP VKSKRERLGR       360
     IVQMHSNSRE EIKEVFAGDI AAAIGLKDVT TGETLCDPKS IITLERMEFP EPVISVAVEP       420
     RTIADQDKMG IALGKLAAED PSFRVQTDEE SGQIIISGMG ELHLDILVER MKREFSVECN       480
     VGKPQVAYRE AIRSTVKVEG KFIRQSGGRG QYGHVWLKLE PMDITDDEAP IYEFVNETVG       540
     GSIPKEYVPA VDKGIQEQMS QGVLAGYPLL GVKATLYDGS FHDVDSNEMA FKIAGSLAMK       600
     QGALQASPVL LEPVMKVEVL TPEANMGDVV GDLNRRRGMI EGMEDALGGL KQINAQVPLS       660
     EMFGYATDLR SATQGRASYS MEFLKYAEAS KHVAETIISA RAVI                        704
//

If you have problems or comments...

PBIL Back to PBIL home page