(data stored in ACNUC7421 zone)

EMBL: CR954246.GALE

CR954246.GALE        Location/Qualifiers
FT   CDS             complement(488463..489476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="PSHAa0469"
FT                   /product="UDP-galactose 4-epimerase"
FT                   /function="2.1 : Metabolism of carbohydrates and related
FT                   molecules"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /function="2.1.3.5 : Biosynthesis and degradation of
FT                   polysaccharides"
FT                   /EC_number="5.1.3.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1956282, 3022232; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85566"
FT                   /db_xref="GOA:Q3IFQ0"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFQ0"
FT                   /protein_id="CAI85566.1"
FT                   /translation="MTILVTGGAGYIGSHTVLELLQQNSNVVVIDNLSNSSSESLTRVK
FT                   KITGKEVTFYQGDILDKAFLDSVFAKHTIESVIHFAGLKAVGESVVKPIEYYQNNVQGT
FT                   LTLVDAMRDAGVFKLVFSSSATVYGDPASLPIKEDFPVGGTTNPYGTSKLMVEMMLQDI
FT                   AKSDERFAFAILRYFNPVGAHESGLIGEDPNGIPNNLLPYISQVAVGKLKQLAVFGDDY
FT                   DTVDGTGVRDYIHVVDLALGHLKALNKIATNTGALVYNLGTGNGYSVLQMVNAFIKASG
FT                   QAVPYQVSPRRPGDIAACYAAPEKALNELDWQAMRGIDTMMQDTWRWQSNNPNGYK"
     MTILVTGGAG YIGSHTVLEL LQQNSNVVVI DNLSNSSSES LTRVKKITGK EVTFYQGDIL        60
     DKAFLDSVFA KHTIESVIHF AGLKAVGESV VKPIEYYQNN VQGTLTLVDA MRDAGVFKLV       120
     FSSSATVYGD PASLPIKEDF PVGGTTNPYG TSKLMVEMML QDIAKSDERF AFAILRYFNP       180
     VGAHESGLIG EDPNGIPNNL LPYISQVAVG KLKQLAVFGD DYDTVDGTGV RDYIHVVDLA       240
     LGHLKALNKI ATNTGALVYN LGTGNGYSVL QMVNAFIKAS GQAVPYQVSP RRPGDIAACY       300
     AAPEKALNEL DWQAMRGIDT MMQDTWRWQS NNPNGYK                                337
//

If you have problems or comments...

PBIL Back to PBIL home page