(data stored in ACNUC7421 zone)

EMBL: CR954246.GLNA

CR954246.GLNA        Location/Qualifiers
FT   CDS             complement(174662..176068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="PSHAa0166"
FT                   /product="glutamine synthetase"
FT                   /function="2.2.1.3 : Glutamate family"
FT                   /EC_number="6.3.1.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2882477, 6148334, 2858855; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85270"
FT                   /db_xref="GOA:Q3IFL0"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFL0"
FT                   /protein_id="CAI85270.1"
FT                   /translation="MSQSVLDFIKENDVKFIDLRFTDTKGKEQHISIPHHQIDEDFFED
FT                   GKMFDGSSIAGWKGINESDMVLMPVAESAKLDPFTEEATLIIRCDVVEPSTLQGYERDP
FT                   RSVAKRAEEYMRSTGIADTVLFGPEPEFFVFDDVKYKTDMSGSMYKIDSKQAAWNSDKE
FT                   YADGNTGHRPGVKGGYFPVAPVDDFQDWRSATCLVLEEMGQVVEAHHHEVATAGQNEIA
FT                   TRFNTMVIKADEIQEMKYVIHNMAHLYGKTATFMPKPIVGDNGSGMHCHQSLAKDGVNL
FT                   FAGDKYGGLSEDALYYIGGIIKHAKAINAFANASTNSYKRLVPGYEAPVMLAYSARNRS
FT                   ASIRIPVVPSAKGRRIEVRFPDATANPYLAFAAMLMAGLDGIKNKIHPGDAMDKDLYDL
FT                   PAEEAAEIPTVASSLEEALASLDADREFLNQGDVFSNDLIDAYIKLKSQEVEKLNMTTH
FT                   PIEFEMYYSC"
     MSQSVLDFIK ENDVKFIDLR FTDTKGKEQH ISIPHHQIDE DFFEDGKMFD GSSIAGWKGI        60
     NESDMVLMPV AESAKLDPFT EEATLIIRCD VVEPSTLQGY ERDPRSVAKR AEEYMRSTGI       120
     ADTVLFGPEP EFFVFDDVKY KTDMSGSMYK IDSKQAAWNS DKEYADGNTG HRPGVKGGYF       180
     PVAPVDDFQD WRSATCLVLE EMGQVVEAHH HEVATAGQNE IATRFNTMVI KADEIQEMKY       240
     VIHNMAHLYG KTATFMPKPI VGDNGSGMHC HQSLAKDGVN LFAGDKYGGL SEDALYYIGG       300
     IIKHAKAINA FANASTNSYK RLVPGYEAPV MLAYSARNRS ASIRIPVVPS AKGRRIEVRF       360
     PDATANPYLA FAAMLMAGLD GIKNKIHPGD AMDKDLYDLP AEEAAEIPTV ASSLEEALAS       420
     LDADREFLNQ GDVFSNDLID AYIKLKSQEV EKLNMTTHPI EFEMYYSC                    468
//

If you have problems or comments...

PBIL Back to PBIL home page