(data stored in ACNUC7421 zone)

EMBL: CR954246.GLNL

CR954246.GLNL        Location/Qualifiers
FT   CDS             complement(172862..173932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnL"
FT                   /locus_tag="PSHAa0164"
FT                   /product="nitrogen availability sensory kinase (soluble) in
FT                   two-component regulatory system with GlnG, nitrogen
FT                   regulation (nitrogen regulator II, NRII)"
FT                   /function="1.3 : Sensors (signal transduction)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11121068, 12562801; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85268"
FT                   /db_xref="GOA:Q3IFL2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFL2"
FT                   /protein_id="CAI85268.1"
FT                   /translation="MLNNTHFSPELLNAIWQNQTTAVMLLNESFTLIYANTSTSELLGL
FT                   GTKRLLGQSFDDLFNYHSIDLKRIAQYSLIDGVDCHQHRADVVFVDSRHAKLAVSSKQI
FT                   KYQGALYILLECRQTDDEIKFDQASNQMHQYQAARNLIRGLAHEIKNPLGGIRGAAQLL
FT                   QYEVDQQERNECAELIIEQADRLRELVDRLLGPNQLPQKSYGNIHQTLESVIKLSTLDN
FT                   SDNIRLVKDYDPSIPDVYIDQSKVQQVVLNIVRNAQQALVNGGEIKIKTRINYQHRRPG
FT                   KAPKKALLIQVLDNGPGIDISVRDTLFYPMITNKDGGSGLGLSIAQTLIDQHNGYIECD
FT                   SWPGHTEFNIYLPFAD"
     MLNNTHFSPE LLNAIWQNQT TAVMLLNESF TLIYANTSTS ELLGLGTKRL LGQSFDDLFN        60
     YHSIDLKRIA QYSLIDGVDC HQHRADVVFV DSRHAKLAVS SKQIKYQGAL YILLECRQTD       120
     DEIKFDQASN QMHQYQAARN LIRGLAHEIK NPLGGIRGAA QLLQYEVDQQ ERNECAELII       180
     EQADRLRELV DRLLGPNQLP QKSYGNIHQT LESVIKLSTL DNSDNIRLVK DYDPSIPDVY       240
     IDQSKVQQVV LNIVRNAQQA LVNGGEIKIK TRINYQHRRP GKAPKKALLI QVLDNGPGID       300
     ISVRDTLFYP MITNKDGGSG LGLSIAQTLI DQHNGYIECD SWPGHTEFNI YLPFAD           356
//

If you have problems or comments...

PBIL Back to PBIL home page