(data stored in ACNUC7421 zone)

EMBL: CR954246.GLPD

CR954246.GLPD        Location/Qualifiers
FT   CDS             complement(199352..200890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpD"
FT                   /locus_tag="PSHAa0189"
FT                   /product="sn-glycerol-3-phosphate dehydrogenase FAD
FT                   binding; dioxygen as acceptor"
FT                   /function="2.1.3.2 : Sugar alcohols"
FT                   /EC_number="1.1.99.5"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11955283; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85292"
FT                   /db_xref="GOA:Q3IK60"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IK60"
FT                   /protein_id="CAI85292.1"
FT                   /translation="MPSLKLIKRYSVKLLDNEYDLLVIGGGVNGTGIAADAAGRGLKVL
FT                   LCEQNDLASATSSSSSKLIHGGLRYLEHYQFRLVKEALKEREVLLKNAPHIMWPLSFRL
FT                   PHQAHLRPYWMIRIGLFIYDHLAKRITLPASKSIKFTRDSILNNTITRGFEYADGWVDD
FT                   SRLVILNALAAQQKGATILSRTRCIKAVRNNNNWSVTLEQQGSKKQCSIVAKGVVNAAG
FT                   PWVASLFDEVITGPSPHNIRLVKGSHIIVPRIHTEPQAYILQNKDQRIIFVTPFEDDYS
FT                   LIGTTDEEYSDNIADVKISDKEVDYLISITNNYFKKQLTHNDIVHTFSGVRPLLDDNSC
FT                   DAQAVTRDYKLILSSNNNQAPLLSVFGGKITTYRKLAENAVNELASFYPHMGQTWTKNT
FT                   PLPGGDFSSKVVLKQQLQVKYAWLPEFILNRFIRSYGTGTYTLLTDAQSVADLGQHFGH
FT                   GLYATEVNYLVNSEWASSAEDILWRRSKLGLRFNTEQITALSQYIQNYNGSIPL"
     MPSLKLIKRY SVKLLDNEYD LLVIGGGVNG TGIAADAAGR GLKVLLCEQN DLASATSSSS        60
     SKLIHGGLRY LEHYQFRLVK EALKEREVLL KNAPHIMWPL SFRLPHQAHL RPYWMIRIGL       120
     FIYDHLAKRI TLPASKSIKF TRDSILNNTI TRGFEYADGW VDDSRLVILN ALAAQQKGAT       180
     ILSRTRCIKA VRNNNNWSVT LEQQGSKKQC SIVAKGVVNA AGPWVASLFD EVITGPSPHN       240
     IRLVKGSHII VPRIHTEPQA YILQNKDQRI IFVTPFEDDY SLIGTTDEEY SDNIADVKIS       300
     DKEVDYLISI TNNYFKKQLT HNDIVHTFSG VRPLLDDNSC DAQAVTRDYK LILSSNNNQA       360
     PLLSVFGGKI TTYRKLAENA VNELASFYPH MGQTWTKNTP LPGGDFSSKV VLKQQLQVKY       420
     AWLPEFILNR FIRSYGTGTY TLLTDAQSVA DLGQHFGHGL YATEVNYLVN SEWASSAEDI       480
     LWRRSKLGLR FNTEQITALS QYIQNYNGSI PL                                     512
//

If you have problems or comments...

PBIL Back to PBIL home page