(data stored in ACNUC7421 zone)

EMBL: CR954246.GLPK

CR954246.GLPK        Location/Qualifiers
FT   CDS             complement(200916..202421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="PSHAa0190"
FT                   /product="glycerol kinase"
FT                   /function="2.1.3.2 : Sugar alcohols"
FT                   /EC_number="2.7.1.30"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85293"
FT                   /db_xref="GOA:Q3IK59"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IK59"
FT                   /protein_id="CAI85293.1"
FT                   /translation="MSKYILSIDQGTTSSRAILFTKDAKVVDTVQQTFPQHFPNNGWVE
FT                   HDPNDILQTVLSTCKTVLANNQVTAEQVIAIGITNQRETTLVWNKKTGQPIYNAIVWQD
FT                   RRTSEYCEQIRSDKLSKKISDKTGLLLDPYFSATKIRWILDNVTDAQQQALAGELAFGT
FT                   VDSYLLWHLTAGKVHRTDATNASRTLLFNIHQQCWDEELLTQFNIPHSMLPEVMDSAAE
FT                   FGSTSSEIFGAPIKICAMAGDQQAALIGQACFKEGMAKSTYGTGCFLMLNTGDKALTSN
FT                   NRLLTTVAYRLNGRVTYAIEGSIFMAGATMQWIVEGLKLLEHAGDSEAMVKDVPLDHGV
FT                   FLVPSFTGLGAPYWDANARGAILGLTRDSGISTIVAAALQSVGYQTKDLQKAMEGDGLR
FT                   PSILRVDGGMAKNNWAMQFLANILGASVERPALTETTSLGVAYLAGLQTGIYKSTEQLA
FT                   TMWQCDRRFEPTMSIDERNDLYAKWQHCIAQVTLSNNATKDDC"
     MSKYILSIDQ GTTSSRAILF TKDAKVVDTV QQTFPQHFPN NGWVEHDPND ILQTVLSTCK        60
     TVLANNQVTA EQVIAIGITN QRETTLVWNK KTGQPIYNAI VWQDRRTSEY CEQIRSDKLS       120
     KKISDKTGLL LDPYFSATKI RWILDNVTDA QQQALAGELA FGTVDSYLLW HLTAGKVHRT       180
     DATNASRTLL FNIHQQCWDE ELLTQFNIPH SMLPEVMDSA AEFGSTSSEI FGAPIKICAM       240
     AGDQQAALIG QACFKEGMAK STYGTGCFLM LNTGDKALTS NNRLLTTVAY RLNGRVTYAI       300
     EGSIFMAGAT MQWIVEGLKL LEHAGDSEAM VKDVPLDHGV FLVPSFTGLG APYWDANARG       360
     AILGLTRDSG ISTIVAAALQ SVGYQTKDLQ KAMEGDGLRP SILRVDGGMA KNNWAMQFLA       420
     NILGASVERP ALTETTSLGV AYLAGLQTGI YKSTEQLATM WQCDRRFEPT MSIDERNDLY       480
     AKWQHCIAQV TLSNNATKDD C                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page