(data stored in ACNUC7421 zone)

EMBL: CR954246.GLYQ

CR954246.GLYQ        Location/Qualifiers
FT   CDS             6349..7251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="PSHAa0005"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /function="3.3.2 : Aminoacyl-tRNA synthetases"
FT                   /EC_number="6.1.1.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7556056, 12572618; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85119"
FT                   /db_xref="GOA:Q3IDE6"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDE6"
FT                   /protein_id="CAI85119.1"
FT                   /translation="MQKYDVKTFQGLILALQDYWAQQGCVIIQPLDMEVGAGTFHPQTF
FT                   LKSIGPEPMSSAYVQPCRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGSLAA
FT                   VGIDTLTDEVRFVEDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECSPVTGEI
FT                   TYGLERLAMYIQGVDSIYDLVWADGPLGRVTYGDVFHQNEVEQSTYNFEHANVEDLFAQ
FT                   FDKCEAESQKLIEANLPLPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRALSKAC
FT                   AQSYYDKREALGFPLCKDK"
     MQKYDVKTFQ GLILALQDYW AQQGCVIIQP LDMEVGAGTF HPQTFLKSIG PEPMSSAYVQ        60
     PCRRPTDGRY GENPNRLQHY YQFQVVLKPS PDNIQELYLG SLAAVGIDTL TDEVRFVEDN       120
     WESPTLGAWG LGWEIWLNGM EVTQFTYFQQ VGGIECSPVT GEITYGLERL AMYIQGVDSI       180
     YDLVWADGPL GRVTYGDVFH QNEVEQSTYN FEHANVEDLF AQFDKCEAES QKLIEANLPL       240
     PAYEQVMKAS HAFNLLDARH AISVTERQRY ILRVRALSKA CAQSYYDKRE ALGFPLCKDK       300
//

If you have problems or comments...

PBIL Back to PBIL home page