(data stored in ACNUC7421 zone)

EMBL: CR954246.GLYS

CR954246.GLYS        Location/Qualifiers
FT   CDS             7254..9323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="PSHAa0006"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /function="3.3.2 : Aminoacyl-tRNA synthetases"
FT                   /EC_number="6.1.1.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6374618, 7556056, 8944770; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85120"
FT                   /db_xref="GOA:Q3IJ28"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IJ28"
FT                   /protein_id="CAI85120.1"
FT                   /translation="MSAQNLLVEIGTEELPPKALRKLAEAFAANLTAELETLELAHQGV
FT                   SWYASPRRLGLRVIALDAKQQDKEVEKRGPAIKAAFDADGNPTKAAMGWARGCGIEVKD
FT                   AQTLETDKGAWLLHLAKVAGQETKTLMVDVINKALAKLPIPKPMRWGANKTQFIRPVHT
FT                   VTILLGDELVTGEVLGKQVSNQLQGHRFHHPEKITINHADDIFDVLKSAYVIADYEQRK
FT                   AQIRAQIEAAAKAINAVVAMDEDLLEEVTSLVEWPVTLTATFEEEFLAVPAEALIYTMK
FT                   DDQKYFPLLDQNGKLLNKFLFVSNIESKDPSVVISGNEKVVRPRLADAQFFFESDKKKT
FT                   LESRLESLDSVLFQKQLGTLKDKSARISELAGYIAQQLGADKELAQRAGLLSKTDLMTE
FT                   MVMEFTDIQGVMGMHYARFDGEAEDVALAQNEQYMPRFAGDSLPTNLISCAVAIADKFD
FT                   TLVGIFGIGQAPKGDKDPFALRRAAIGALRIMVEKELPLDILDLVAKSQTLFGDKLTNL
FT                   NVSTDVFEFMLGRFRAWYQDEGIEVDVIQAVLARRPTKPVDFDRRVKAVSHFRTLDAAE
FT                   ALAAANKRVSNILAKNDITSEGNVDESLLTDDAEKVLAAQVAKFATELAPLYASGNYQE
FT                   ALSQLAGIRQSVDSFFDNVMVMADDEAVKQNRLALLSQLSGLFLGIADISVLQK"
     MSAQNLLVEI GTEELPPKAL RKLAEAFAAN LTAELETLEL AHQGVSWYAS PRRLGLRVIA        60
     LDAKQQDKEV EKRGPAIKAA FDADGNPTKA AMGWARGCGI EVKDAQTLET DKGAWLLHLA       120
     KVAGQETKTL MVDVINKALA KLPIPKPMRW GANKTQFIRP VHTVTILLGD ELVTGEVLGK       180
     QVSNQLQGHR FHHPEKITIN HADDIFDVLK SAYVIADYEQ RKAQIRAQIE AAAKAINAVV       240
     AMDEDLLEEV TSLVEWPVTL TATFEEEFLA VPAEALIYTM KDDQKYFPLL DQNGKLLNKF       300
     LFVSNIESKD PSVVISGNEK VVRPRLADAQ FFFESDKKKT LESRLESLDS VLFQKQLGTL       360
     KDKSARISEL AGYIAQQLGA DKELAQRAGL LSKTDLMTEM VMEFTDIQGV MGMHYARFDG       420
     EAEDVALAQN EQYMPRFAGD SLPTNLISCA VAIADKFDTL VGIFGIGQAP KGDKDPFALR       480
     RAAIGALRIM VEKELPLDIL DLVAKSQTLF GDKLTNLNVS TDVFEFMLGR FRAWYQDEGI       540
     EVDVIQAVLA RRPTKPVDFD RRVKAVSHFR TLDAAEALAA ANKRVSNILA KNDITSEGNV       600
     DESLLTDDAE KVLAAQVAKF ATELAPLYAS GNYQEALSQL AGIRQSVDSF FDNVMVMADD       660
     EAVKQNRLAL LSQLSGLFLG IADISVLQK                                         689
//

If you have problems or comments...

PBIL Back to PBIL home page