(data stored in ACNUC7421 zone)

EMBL: CR954246.GOR

CR954246.GOR         Location/Qualifiers
FT   CDS             complement(374336..375697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="PSHAa0360"
FT                   /product="Glutathione reductase"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /EC_number="1.8.1.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3521741; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85458"
FT                   /db_xref="GOA:Q3IIA8"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIA8"
FT                   /protein_id="CAI85458.1"
FT                   /translation="MAQHFDYIAIGGGSGGIASANRAAMRGAKVALIEAKHMGGTCVNV
FT                   GCVPKKVMWHGAQVAEAINLYAPDYGFNVEVKGFDWGKLVESREAYIGRIHKGYDNGLA
FT                   NNGVTVIKGFAKFVDNKTVEVDGEHYTADHILIAVGGRPSIPNIEGAEHGIDSNGFFEL
FT                   KEQPKRVAVIGAGYIAVELAGVLHSLGTDTHLFVRKHAPLRNFDPYIIDTLVEVMAKEG
FT                   PTLHTESVPHKLVKEDDGSVTLHLDNGKSHNVDQVIWAIGREPTTNAINIAAAGVEVNS
FT                   KGFVKVDEYQNTTAKNVYAVGDIIENGIELTPVAVKAGRTLSERLFNKELPDDLKMDYS
FT                   LVPTVVFSHPPIGTIGLTEQEAISQYGAENVKVYQSAFAAMYTAVTQHRQPCKMKLVCA
FT                   GPDEKVVGLHGIGFAVDEMIQGFAVAMKMGATKADFDAVVAIHPTGSEEFVTMR"
     MAQHFDYIAI GGGSGGIASA NRAAMRGAKV ALIEAKHMGG TCVNVGCVPK KVMWHGAQVA        60
     EAINLYAPDY GFNVEVKGFD WGKLVESREA YIGRIHKGYD NGLANNGVTV IKGFAKFVDN       120
     KTVEVDGEHY TADHILIAVG GRPSIPNIEG AEHGIDSNGF FELKEQPKRV AVIGAGYIAV       180
     ELAGVLHSLG TDTHLFVRKH APLRNFDPYI IDTLVEVMAK EGPTLHTESV PHKLVKEDDG       240
     SVTLHLDNGK SHNVDQVIWA IGREPTTNAI NIAAAGVEVN SKGFVKVDEY QNTTAKNVYA       300
     VGDIIENGIE LTPVAVKAGR TLSERLFNKE LPDDLKMDYS LVPTVVFSHP PIGTIGLTEQ       360
     EAISQYGAEN VKVYQSAFAA MYTAVTQHRQ PCKMKLVCAG PDEKVVGLHG IGFAVDEMIQ       420
     GFAVAMKMGA TKADFDAVVA IHPTGSEEFV TMR                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page