(data stored in ACNUC7421 zone)

EMBL: CR954246.GPMM

CR954246.GPMM        Location/Qualifiers
FT   CDS             complement(382408..383952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmM"
FT                   /locus_tag="PSHAa0366"
FT                   /product="phosphoglycerate mutase III,
FT                   cofactor-independent"
FT                   /function="2.1.1.1 : Glycolysis/gluconeogenesis"
FT                   /EC_number="5.4.2.1"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85464"
FT                   /db_xref="GOA:Q3IIE4"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IIE4"
FT                   /protein_id="CAI85464.1"
FT                   /translation="MSEHKKPLVLMILDGWGYREDEQSNAILAANTPVLDELWATRPRT
FT                   LISASGFDVGLPDGQMGNSEVGHVNLGAGRVVYQDFTRITKAINDGEFDSTPALVDNID
FT                   KAVSADKAVHIMGLLSPGGVHSHEDHIVASIELAAKRGAKEVYFHGFLDGRDTPPRSAK
FT                   ASIERIEAVFAKLQCGRLASLIGRYYAMDRDNRWNRVEKAYNLLTLAQGDFSYPTGVSA
FT                   LEAAYERDENDEFVAASTITPAGAEPVQINDGDTVIFANFRADRAREITRAFVEPNFDG
FT                   FAKQKSPALSAFVMMTEYAADIDAPVAFGPTPLVNVLGEWFEKHGKTQLRISETEKYAH
FT                   VTFFFSGGREDEFNGETRELIPSPQVATYDLQPEMNSEMLTDKLVAAIKSGKYDAIICN
FT                   YPNGDMVGHSGVFAAAVKACEAVDHCIGRVVAALNKYGGEALITADHGNAEQMANLKTG
FT                   QAHTAHTSEPVPFIYVGRDATASEGKALSDVAPTMLHLMGMEQPTEMTGKPIMTLK"
     MSEHKKPLVL MILDGWGYRE DEQSNAILAA NTPVLDELWA TRPRTLISAS GFDVGLPDGQ        60
     MGNSEVGHVN LGAGRVVYQD FTRITKAIND GEFDSTPALV DNIDKAVSAD KAVHIMGLLS       120
     PGGVHSHEDH IVASIELAAK RGAKEVYFHG FLDGRDTPPR SAKASIERIE AVFAKLQCGR       180
     LASLIGRYYA MDRDNRWNRV EKAYNLLTLA QGDFSYPTGV SALEAAYERD ENDEFVAAST       240
     ITPAGAEPVQ INDGDTVIFA NFRADRAREI TRAFVEPNFD GFAKQKSPAL SAFVMMTEYA       300
     ADIDAPVAFG PTPLVNVLGE WFEKHGKTQL RISETEKYAH VTFFFSGGRE DEFNGETREL       360
     IPSPQVATYD LQPEMNSEML TDKLVAAIKS GKYDAIICNY PNGDMVGHSG VFAAAVKACE       420
     AVDHCIGRVV AALNKYGGEA LITADHGNAE QMANLKTGQA HTAHTSEPVP FIYVGRDATA       480
     SEGKALSDVA PTMLHLMGME QPTEMTGKPI MTLK                                   514
//

If you have problems or comments...

PBIL Back to PBIL home page