(data stored in ACNUC7421 zone)

EMBL: CR954246.GPPA

CR954246.GPPA        Location/Qualifiers
FT   CDS             122098..123525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gppA"
FT                   /locus_tag="PSHAa0115"
FT                   /product="Guanosine-5'-triphosphate,3'-diphosphate
FT                   pyrophosphatase (Guanosine pentaphosphate phosphohydrolase)
FT                   (pppGpp-5'-phosphohydrolase)"
FT                   /EC_number="3.6.1.40"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8394006; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85224"
FT                   /db_xref="GOA:Q3IDD5"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR023709"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDD5"
FT                   /protein_id="CAI85224.1"
FT                   /translation="MLIAKSIAGGLQTIGRVKRKVRLAAGLDIDNVLSSEAMHRGWECL
FT                   ALFAERLQDIPKQNITIVATATLRLASNADVFKAQAEKILGHKVNVISGELEARTIYKG
FT                   VAHTSSCTGSQLVIDIGGASTEVIIGKNFDALLYKSLNIGCVTYLERYFKDCKLSNANF
FT                   NTAIKAARTVIDEIASEYKVKGWQIASGASGTVQAIQEIMIAQNLDELLTLEKLYTIKK
FT                   QSIAYKTIAALDLPGLSEDRRLVFVSGLAILIALFESLEIEKMGLAGGALREGVLYSML
FT                   PELHNSDIRKRTIDGFIDRYHVDQKQASRVASLVLNLASEVNESWPIKALNGLPLLTAV
FT                   AQLHEIGLLIEYKQYHKHSAYILKNTEMPGFSQSEHKVIVAVAKGHRSDLQKGYFDSLG
FT                   ANSVLAQYLVRLIRIAVILCMRRQDDVLPEFAITVKDDVLNLQFENDWLKNHPLMASEL
FT                   QQESKQQAKLGWKLIVN"
     MLIAKSIAGG LQTIGRVKRK VRLAAGLDID NVLSSEAMHR GWECLALFAE RLQDIPKQNI        60
     TIVATATLRL ASNADVFKAQ AEKILGHKVN VISGELEART IYKGVAHTSS CTGSQLVIDI       120
     GGASTEVIIG KNFDALLYKS LNIGCVTYLE RYFKDCKLSN ANFNTAIKAA RTVIDEIASE       180
     YKVKGWQIAS GASGTVQAIQ EIMIAQNLDE LLTLEKLYTI KKQSIAYKTI AALDLPGLSE       240
     DRRLVFVSGL AILIALFESL EIEKMGLAGG ALREGVLYSM LPELHNSDIR KRTIDGFIDR       300
     YHVDQKQASR VASLVLNLAS EVNESWPIKA LNGLPLLTAV AQLHEIGLLI EYKQYHKHSA       360
     YILKNTEMPG FSQSEHKVIV AVAKGHRSDL QKGYFDSLGA NSVLAQYLVR LIRIAVILCM       420
     RRQDDVLPEF AITVKDDVLN LQFENDWLKN HPLMASELQQ ESKQQAKLGW KLIVN            475
//

If you have problems or comments...

PBIL Back to PBIL home page