(data stored in ACNUC7421 zone)

EMBL: CR954246.GPSA

CR954246.GPSA        Location/Qualifiers
FT   CDS             385843..386850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="PSHAa0370"
FT                   /product="glycerol-3-phosphate dehydrogenase (NAD+)"
FT                   /function="2.4.1.1 : Biosynthesis"
FT                   /EC_number="1.1.1.94"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9426138; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85468"
FT                   /db_xref="GOA:Q3IIE0"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IIE0"
FT                   /protein_id="CAI85468.1"
FT                   /translation="MSTATSAVTVLGAGSYGTALAICLARNGHQVTLWGRNSDDVATLA
FT                   AERKNQRYLPDIPFPDTLTLEADLQRAAASNEIVLVVVPSHAFGDTLKQIKPALQQGAK
FT                   VAWATKGLEPNTGRLLQEVAVQELGDAIPLAVLSGPTFAKEMAMGSPTAISVSSTSTEF
FT                   AQQLADLLHCGRSFRVYNNDDFIGIQLGGAVKNVIAIGAGISDGVGFGANARTALITRG
FT                   LAELTRLGCALGAKPETFMGMAGLGDLILTCTDNQSRNRRFGLALGKGESVEAAIESIG
FT                   QVVEGFRNTKEVYLLAQRSGVEMPITEQIYKVLYENKDMKEAAMALLGREQRSE"
     MSTATSAVTV LGAGSYGTAL AICLARNGHQ VTLWGRNSDD VATLAAERKN QRYLPDIPFP        60
     DTLTLEADLQ RAAASNEIVL VVVPSHAFGD TLKQIKPALQ QGAKVAWATK GLEPNTGRLL       120
     QEVAVQELGD AIPLAVLSGP TFAKEMAMGS PTAISVSSTS TEFAQQLADL LHCGRSFRVY       180
     NNDDFIGIQL GGAVKNVIAI GAGISDGVGF GANARTALIT RGLAELTRLG CALGAKPETF       240
     MGMAGLGDLI LTCTDNQSRN RRFGLALGKG ESVEAAIESI GQVVEGFRNT KEVYLLAQRS       300
     GVEMPITEQI YKVLYENKDM KEAAMALLGR EQRSE                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page