(data stored in ACNUC7421 zone)

EMBL: CR954246.GROL

CR954246.GROL        Location/Qualifiers
FT   CDS             complement(272763..274406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="PSHAa0259"
FT                   /product="60 kDa chaperonin (Protein Cpn60) (groEL
FT                   protein)"
FT                   /function="1.7 : Cell division"
FT                   /function="3.3.7 : Protein folding"
FT                   /note="Evidence 1 : Function experimentally demonstrated in
FT                   the studied organism; PubMedId : 15225312, 15294778;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85358"
FT                   /db_xref="GOA:Q9XAU7"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9XAU7"
FT                   /protein_id="CAI85358.1"
FT                   /translation="MAAKEVLFAGDARAKMLTGVNILANAVKVTLGPKGRNVVLDKSFG
FT                   SPVITKDGVSVAKEIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIVNEGL
FT                   KAVAAGMNPMDLKRGIDKAVIAAVAELKALSVPCSDTKAIAQVGTISANSDKEIGDIIA
FT                   QAMEKVGRNSGVITVEEGQSLENELDVVEGMQFDRGYLSPYFINSPEKGTVELDNPFIL
FT                   LVDKKISNIRELLPTLEAVAKASKPLLIIAEDLEGEALATLVVNNMRGIVKVSAVKAPG
FT                   FGDRRKAMLQDIAVLTGGTVISEEIGLELEKATVEDLGTAKRVIITKDDTTIIDGAGEE
FT                   AGINGRVSQIKAQIEEATSDYDKEKLQERMAKLAGGVAVIKVGAATEMEMKEKKDRVED
FT                   ALNATRAAVEEGVVPGGGVALVRAASKLVDLVGDNEDQNHGIKVALRAMEAPLRQIVTN
FT                   AGDEASVVINAVKAGSGNFGYNAATGEYNDMIEMGILDPTKVTRSALQFAGSIAGLMIT
FT                   TEAMVAEIPKDDSAPDMGGMGGMGGMGGMM"
     MAAKEVLFAG DARAKMLTGV NILANAVKVT LGPKGRNVVL DKSFGSPVIT KDGVSVAKEI        60
     ELEDKFENMG AQMVKEVASK ANDAAGDGTT TATVLAQSIV NEGLKAVAAG MNPMDLKRGI       120
     DKAVIAAVAE LKALSVPCSD TKAIAQVGTI SANSDKEIGD IIAQAMEKVG RNSGVITVEE       180
     GQSLENELDV VEGMQFDRGY LSPYFINSPE KGTVELDNPF ILLVDKKISN IRELLPTLEA       240
     VAKASKPLLI IAEDLEGEAL ATLVVNNMRG IVKVSAVKAP GFGDRRKAML QDIAVLTGGT       300
     VISEEIGLEL EKATVEDLGT AKRVIITKDD TTIIDGAGEE AGINGRVSQI KAQIEEATSD       360
     YDKEKLQERM AKLAGGVAVI KVGAATEMEM KEKKDRVEDA LNATRAAVEE GVVPGGGVAL       420
     VRAASKLVDL VGDNEDQNHG IKVALRAMEA PLRQIVTNAG DEASVVINAV KAGSGNFGYN       480
     AATGEYNDMI EMGILDPTKV TRSALQFAGS IAGLMITTEA MVAEIPKDDS APDMGGMGGM       540
     GGMGGMM                                                                 547
//

If you have problems or comments...

PBIL Back to PBIL home page