(data stored in ACNUC7421 zone)

EMBL: CR954246.GROS

CR954246.GROS        Location/Qualifiers
FT   CDS             complement(274455..274742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groS"
FT                   /locus_tag="PSHAa0260"
FT                   /product="10 kDa chaperonin (Protein Cpn10) (groES
FT                   protein)"
FT                   /function="1.7 : Cell division"
FT                   /note="Evidence 1 : Function experimentally demonstrated in
FT                   the studied organism; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85359"
FT                   /db_xref="GOA:Q9AKT2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9AKT2"
FT                   /protein_id="CAI85359.1"
FT                   /translation="MNIRPLHDRVIVKRLEEETKSAGGIVLTGSAAEKSTRGEVVAVGN
FT                   GRILESGDVRALEVKAGDTVLFGSYVEKVEKIEGQEYLIMREDNILGIVG"
     MNIRPLHDRV IVKRLEEETK SAGGIVLTGS AAEKSTRGEV VAVGNGRILE SGDVRALEVK        60
     AGDTVLFGSY VEKVEKIEGQ EYLIMREDNI LGIVG                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page