(data stored in ACNUC7421 zone)

EMBL: CR954246.GSPC

CR954246.GSPC        Location/Qualifiers
FT   CDS             244836..245777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspC"
FT                   /locus_tag="PSHAa0231"
FT                   /product="putative general secretion pathway protein C"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85334"
FT                   /db_xref="GOA:Q3ILN1"
FT                   /db_xref="InterPro:IPR001639"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN1"
FT                   /protein_id="CAI85334.1"
FT                   /translation="MEQQVQQFKHFISRLPHAKLSAVVTLLVVVYIAFLSSKLVWLMWP
FT                   NPIVSPLTPIYYGQHSTAASNNYSQHIIEQFIFGKIIVKSKSDDHAAKVVNDAPETRLS
FT                   INLTGIVAVNNDDKAGLAIIESQGKQETYLVDEAVQGTRAKLAQILPDRVILTVNGRFE
FT                   TLMLDGLDFTKTVSMPVLAARDEAEMGPQLGPAPSEQQIDVTADPNIKQALIETREELL
FT                   EEPGKLFDYIRVSQAMSDGELIGYRLSPGKEPELFKQMGLQNNDLAVAINGYQLTDLKQ
FT                   AMAAINELRNSTDATITIERDNQQIDVQFSLQ"
     MEQQVQQFKH FISRLPHAKL SAVVTLLVVV YIAFLSSKLV WLMWPNPIVS PLTPIYYGQH        60
     STAASNNYSQ HIIEQFIFGK IIVKSKSDDH AAKVVNDAPE TRLSINLTGI VAVNNDDKAG       120
     LAIIESQGKQ ETYLVDEAVQ GTRAKLAQIL PDRVILTVNG RFETLMLDGL DFTKTVSMPV       180
     LAARDEAEMG PQLGPAPSEQ QIDVTADPNI KQALIETREE LLEEPGKLFD YIRVSQAMSD       240
     GELIGYRLSP GKEPELFKQM GLQNNDLAVA INGYQLTDLK QAMAAINELR NSTDATITIE       300
     RDNQQIDVQF SLQ                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page