(data stored in ACNUC7421 zone)

EMBL: CR954246.GSPF

CR954246.GSPF        Location/Qualifiers
FT   CDS             249428..250663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspF"
FT                   /locus_tag="PSHAa0234"
FT                   /product="putative general secretion pathway protein F"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85337"
FT                   /db_xref="GOA:Q3ILN8"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN8"
FT                   /protein_id="CAI85337.1"
FT                   /translation="MAAFEYRALDGRGKEKKGILEADTAKQIRQILRDQKLTPLEVVPA
FT                   AQSDKQVKGQKTSLLGGLFKPTISTSDLALITRQLATLIQSALPVEGAVMAVAEQCEKP
FT                   RLKRMLMSVRSKVVEGYTLADGMSEFPHVFDDLYRAMVAAGEKSGHLDQVLNRLADYTE
FT                   QRQYMRSQITQAMVYPIILVVFAIAIVSVLLGTVVPKILKTFEKTKQVLPWTTEWVMAG
FT                   SHFVQNYWFISLIVITALAIGIKHALKQPKIRFWWDDKILHMPGIGKVARGINTARFAR
FT                   TLSILSSSSVPLLEGMRIAGGVLINEKIKKAVADAADRVSEGASLRAALQQTKLFPPMM
FT                   LHMIASGEKSGELEQMLERAANNQDREFESMVNVSLKLLEPAMIALMAVIVLFIVMAIL
FT                   QPIMAMNKAVGL"
     MAAFEYRALD GRGKEKKGIL EADTAKQIRQ ILRDQKLTPL EVVPAAQSDK QVKGQKTSLL        60
     GGLFKPTIST SDLALITRQL ATLIQSALPV EGAVMAVAEQ CEKPRLKRML MSVRSKVVEG       120
     YTLADGMSEF PHVFDDLYRA MVAAGEKSGH LDQVLNRLAD YTEQRQYMRS QITQAMVYPI       180
     ILVVFAIAIV SVLLGTVVPK ILKTFEKTKQ VLPWTTEWVM AGSHFVQNYW FISLIVITAL       240
     AIGIKHALKQ PKIRFWWDDK ILHMPGIGKV ARGINTARFA RTLSILSSSS VPLLEGMRIA       300
     GGVLINEKIK KAVADAADRV SEGASLRAAL QQTKLFPPMM LHMIASGEKS GELEQMLERA       360
     ANNQDREFES MVNVSLKLLE PAMIALMAVI VLFIVMAILQ PIMAMNKAVG L                411
//

If you have problems or comments...

PBIL Back to PBIL home page