(data stored in ACNUC7421 zone)

EMBL: CR954246.GSPG

CR954246.GSPG        Location/Qualifiers
FT   CDS             250765..251151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspG"
FT                   /locus_tag="PSHAa0235"
FT                   /product="putative general secretion pathway protein G
FT                   [Precursor]"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 7896718; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85338"
FT                   /db_xref="GOA:Q3ILN7"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN7"
FT                   /protein_id="CAI85338.1"
FT                   /translation="MVVLVIIGMIMSIVAPNIMGQQEEAAIDKAHLDIQQLEDAMSLYK
FT                   LKNKSYPSTEQGLEALVNKTSIEPIPKRFPDGGFISKLPEDPWGNTYQLISPGEIGKFD
FT                   IFSLGPDGQAGTDDDIGNWDEEKQ"
     MVVLVIIGMI MSIVAPNIMG QQEEAAIDKA HLDIQQLEDA MSLYKLKNKS YPSTEQGLEA        60
     LVNKTSIEPI PKRFPDGGFI SKLPEDPWGN TYQLISPGEI GKFDIFSLGP DGQAGTDDDI       120
     GNWDEEKQ                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page