(data stored in ACNUC7421 zone)

EMBL: CR954246.GSPH

CR954246.GSPH        Location/Qualifiers
FT   CDS             251201..251785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspH"
FT                   /locus_tag="PSHAa0236"
FT                   /product="putative general secretion pathway protein H
FT                   precursor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 7896718; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85339"
FT                   /db_xref="GOA:Q3ILN6"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN6"
FT                   /protein_id="CAI85339.1"
FT                   /translation="MQVSSERLRAKSRGFSLIEILVVLVIIAFATKMVVYSLEGGAEDE
FT                   LDTQALRLHTTINMASEFAILNQVELGFHIDNNVFEFLVFDGEKWVSFVREALFEPVEF
FT                   DPRFKLALNLDDLAWAQDNLLEQANWRELMSGDEDSLLELKKFKIPQVLILSSGEVSAF
FT                   QLTLELKEQSEPVYFIEGEFTAPVNLRREPE"
     MQVSSERLRA KSRGFSLIEI LVVLVIIAFA TKMVVYSLEG GAEDELDTQA LRLHTTINMA        60
     SEFAILNQVE LGFHIDNNVF EFLVFDGEKW VSFVREALFE PVEFDPRFKL ALNLDDLAWA       120
     QDNLLEQANW RELMSGDEDS LLELKKFKIP QVLILSSGEV SAFQLTLELK EQSEPVYFIE       180
     GEFTAPVNLR REPE                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page