(data stored in ACNUC7421 zone)

EMBL: CR954246.GSPI

CR954246.GSPI        Location/Qualifiers
FT   CDS             251785..252162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspI"
FT                   /locus_tag="PSHAa0237"
FT                   /product="putative general secretion pathway protein I
FT                   [precursor]"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85340"
FT                   /db_xref="GOA:Q3ILN5"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN5"
FT                   /protein_id="CAI85340.1"
FT                   /translation="MRQYNKGFTLLEVLVALSICAMAGIAAMQATSEHIHHLSSIEEQT
FT                   YASWVAENIMVEQRTKGEQWEGKDGVRGSEVMAGVEWFWRQDIGKTADKDFVKLTINIF
FT                   SDEKYEHSVYELATYLNKGKK"
     MRQYNKGFTL LEVLVALSIC AMAGIAAMQA TSEHIHHLSS IEEQTYASWV AENIMVEQRT        60
     KGEQWEGKDG VRGSEVMAGV EWFWRQDIGK TADKDFVKLT INIFSDEKYE HSVYELATYL       120
     NKGKK                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page