(data stored in ACNUC7421 zone)

EMBL: CR954246.GSPJ

CR954246.GSPJ        Location/Qualifiers
FT   CDS             252163..252837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspJ"
FT                   /locus_tag="PSHAa0238"
FT                   /product="putative general secretion pathway protein J
FT                   [Precursor]"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85341"
FT                   /db_xref="GOA:Q3ILN4"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN4"
FT                   /protein_id="CAI85341.1"
FT                   /translation="MKQRGFTLLEVMVALGILGFVIMATHQILDTTTRAKEASDDKIAE
FT                   LNGLQTTFRLMDQDFSQMTKRAVRNEAGDVQEQYLLAGRYVLDSQYDGIGFVRDGWINP
FT                   INLLPRSELQAVGYRVINDNLERVYRVYVDQLDNMEPRVQVVLKNIEELKFEFLDDKNE
FT                   WQAKWQIKALPKAVAVTLQQIEAEPIRRVFLVPGQGKEILPSSPSTDDALADEGNPQEG
FT                   GQ"
     MKQRGFTLLE VMVALGILGF VIMATHQILD TTTRAKEASD DKIAELNGLQ TTFRLMDQDF        60
     SQMTKRAVRN EAGDVQEQYL LAGRYVLDSQ YDGIGFVRDG WINPINLLPR SELQAVGYRV       120
     INDNLERVYR VYVDQLDNME PRVQVVLKNI EELKFEFLDD KNEWQAKWQI KALPKAVAVT       180
     LQQIEAEPIR RVFLVPGQGK EILPSSPSTD DALADEGNPQ EGGQ                        224
//

If you have problems or comments...

PBIL Back to PBIL home page