(data stored in ACNUC7421 zone)

EMBL: CR954246.GSPK

CR954246.GSPK        Location/Qualifiers
FT   CDS             252837..253823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspK"
FT                   /locus_tag="PSHAa0239"
FT                   /product="putative general secretion pathway protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85342"
FT                   /db_xref="GOA:Q3ILN3"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN3"
FT                   /protein_id="CAI85342.1"
FT                   /translation="MGLRSSRGAALVIVLFIVALAAILAVEMSANLMVQVQKSTNLQGH
FT                   QQAKWYAYGAEELAIKALIKSKRDDPDKTTLDQIWAQQGDIPYPVDNGTLSGKITDLQA
FT                   CLNLNAIAVEPDLNSASKTNPAHKALFALLENIEDLPAQESEETMADSVFDWLDENSIT
FT                   YRSGAEEGEYLSRQFPYMTANSLFASTSELRLVKGFNPLVMEKVLPYVCVIPGSTLLSI
FT                   NVNTLAAEQALILSTLIDELSVSGAEAVIAARPDAGFESKAAFFEQVQQQGGQNVKAVE
FT                   KLFSINSEYFKLQTQANFVDLRFSMTTLLHAKDGDVTILARKFGGVQ"
     MGLRSSRGAA LVIVLFIVAL AAILAVEMSA NLMVQVQKST NLQGHQQAKW YAYGAEELAI        60
     KALIKSKRDD PDKTTLDQIW AQQGDIPYPV DNGTLSGKIT DLQACLNLNA IAVEPDLNSA       120
     SKTNPAHKAL FALLENIEDL PAQESEETMA DSVFDWLDEN SITYRSGAEE GEYLSRQFPY       180
     MTANSLFAST SELRLVKGFN PLVMEKVLPY VCVIPGSTLL SINVNTLAAE QALILSTLID       240
     ELSVSGAEAV IAARPDAGFE SKAAFFEQVQ QQGGQNVKAV EKLFSINSEY FKLQTQANFV       300
     DLRFSMTTLL HAKDGDVTIL ARKFGGVQ                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page