(data stored in ACNUC7421 zone)

EMBL: CR954246.GYRB

CR954246.GYRB        Location/Qualifiers
FT   CDS             3782..6208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="PSHAa0004"
FT                   /product="DNA gyrase, subunit B (type II topoisomerase)"
FT                   /function="3.1.3 : DNA packaging and segregation"
FT                   /function="3.2.1.1 : Regulation"
FT                   /EC_number="5.99.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8982450, 11125132; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85118"
FT                   /db_xref="GOA:Q3IDE7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDE7"
FT                   /protein_id="CAI85118.1"
FT                   /translation="MSENYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVD
FT                   NSIDEALAGHCDDIFVTIHLDGSVSVRDNGRGIPTSIHEEEGVSAAEVIMTVLHAGGKF
FT                   DDNSYKVSGGLHGVGVSVVNALSEKLKLTIRREGKLHEQTYSHGVPDAPLAVIGDADTT
FT                   GTELRFWPSDQTFTNLDFHYDILAKRLRELSFLNSGVSIILNDEREENKSDHFKYEGGI
FT                   RAFVEYLNRNKTPIHKGVFHFTHTREEDGIVVEVSMQWNDAYQENIYCFTNNIPQRDGG
FT                   THLAGFRSALTRTLNNYMEKEGFNKKAKTTSNATGDDAREGLTAVVSVKVPDPKFSSQT
FT                   KDKLVSSEVKSAVEQAMAEKFTEFLLEHPTDAKIVVGKIIDASRAREAARKAREMTRRK
FT                   GAMDLAGLPGKLADCQEKDPAQSELYIVEGDSAGGSAKQGRNRKNQAILPLKGKILNVE
FT                   KARFDKMLSSQEVATLITALGCGIGRDEYNPEKLRYHRIIIMTDADVDGSHIRTLLLTF
FT                   FYRQMPEIVERGYIYIAQPPLYKVKKGKQERYIKDDPALVEYLTTLALNNATLYTSTDA
FT                   SGIEGEALEKIVHDYQNTVKVIERLKRKFPNTVMNRLIYQSELKKEDLSDEAKVIAWTK
FT                   ELVDDLIDRDEDATIFQAATEHDTERNLYYPVVKIRQHGVDKAHVLHYDFIASRDYQRI
FT                   AVTGVNIANIITEGAYIQRGEKTQPVDNFVDALEWLIAESKRGLYIQRYKGLGEMNPSQ
FT                   LWETTMDPDARRMLQVTVEDAVAADQLFATLMGDQVEPRREFIEQNALRVVNLDV"
     MSENYDSSSI KVLKGLDAVR KRPGMYIGDT DDGTGLHHMV FEVVDNSIDE ALAGHCDDIF        60
     VTIHLDGSVS VRDNGRGIPT SIHEEEGVSA AEVIMTVLHA GGKFDDNSYK VSGGLHGVGV       120
     SVVNALSEKL KLTIRREGKL HEQTYSHGVP DAPLAVIGDA DTTGTELRFW PSDQTFTNLD       180
     FHYDILAKRL RELSFLNSGV SIILNDEREE NKSDHFKYEG GIRAFVEYLN RNKTPIHKGV       240
     FHFTHTREED GIVVEVSMQW NDAYQENIYC FTNNIPQRDG GTHLAGFRSA LTRTLNNYME       300
     KEGFNKKAKT TSNATGDDAR EGLTAVVSVK VPDPKFSSQT KDKLVSSEVK SAVEQAMAEK       360
     FTEFLLEHPT DAKIVVGKII DASRAREAAR KAREMTRRKG AMDLAGLPGK LADCQEKDPA       420
     QSELYIVEGD SAGGSAKQGR NRKNQAILPL KGKILNVEKA RFDKMLSSQE VATLITALGC       480
     GIGRDEYNPE KLRYHRIIIM TDADVDGSHI RTLLLTFFYR QMPEIVERGY IYIAQPPLYK       540
     VKKGKQERYI KDDPALVEYL TTLALNNATL YTSTDASGIE GEALEKIVHD YQNTVKVIER       600
     LKRKFPNTVM NRLIYQSELK KEDLSDEAKV IAWTKELVDD LIDRDEDATI FQAATEHDTE       660
     RNLYYPVVKI RQHGVDKAHV LHYDFIASRD YQRIAVTGVN IANIITEGAY IQRGEKTQPV       720
     DNFVDALEWL IAESKRGLYI QRYKGLGEMN PSQLWETTMD PDARRMLQVT VEDAVAADQL       780
     FATLMGDQVE PRREFIEQNA LRVVNLDV                                          808
//

If you have problems or comments...

PBIL Back to PBIL home page