(data stored in ACNUC7421 zone)

EMBL: CR954246.HEMC

CR954246.HEMC        Location/Qualifiers
FT   CDS             99281..100219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="PSHAa0098"
FT                   /product="hydroxymethylbilane synthase (porphobilinogen
FT                   deaminase)"
FT                   /function="2.5.12 : Heme, porphyrin, and cobalamin"
FT                   /EC_number="2.5.1.61"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8117733, 8874804; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85207"
FT                   /db_xref="GOA:Q3IF72"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF72"
FT                   /protein_id="CAI85207.1"
FT                   /translation="MTQTTNIVRIATRKSALALWQAEFVKAQLEHYHPGILVELVPMST
FT                   QGDIILDTPLAKIGGKGLFVKELEQAMLEGLADMAVHSMKDMPVEFPEGLTLHTICERE
FT                   DPRDAFVSNNFANIDELPQGAIVGTSSLRRQCQIRASRPDLKIHDLRGNVNTRLAKLDS
FT                   GQYDAIILAAAGLIRLEMKDRIRAYIEPEVSLPANGQGAVGIECRTDDEAIKALLAPLE
FT                   HSETRIRVNAERAMNRHLEGGCQVPIGAYALVNGDQVHLRGLVGAIDGSEILRDEVSGH
FT                   VNDAEKLGVELAKMLLAQGADRILAEVYRDA"
     MTQTTNIVRI ATRKSALALW QAEFVKAQLE HYHPGILVEL VPMSTQGDII LDTPLAKIGG        60
     KGLFVKELEQ AMLEGLADMA VHSMKDMPVE FPEGLTLHTI CEREDPRDAF VSNNFANIDE       120
     LPQGAIVGTS SLRRQCQIRA SRPDLKIHDL RGNVNTRLAK LDSGQYDAII LAAAGLIRLE       180
     MKDRIRAYIE PEVSLPANGQ GAVGIECRTD DEAIKALLAP LEHSETRIRV NAERAMNRHL       240
     EGGCQVPIGA YALVNGDQVH LRGLVGAIDG SEILRDEVSG HVNDAEKLGV ELAKMLLAQG       300
     ADRILAEVYR DA                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page