(data stored in ACNUC7421 zone)

EMBL: CR954246.HEMDX

CR954246.HEMDX       Location/Qualifiers
FT   CDS             100219..102069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemDX"
FT                   /locus_tag="PSHAa0099"
FT                   /product="uroporphyrinogen-III synthase HemD (N
FT                   terminal)/Uroporphyrin-III C-methyltransferase (C
FT                   terminal)"
FT                   /function="2.5.12 : Heme, porphyrin, and cobalamin"
FT                   /EC_number="4.2.1.75"
FT                   /EC_number="2.1.1.107"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 3062586; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85208"
FT                   /db_xref="GOA:Q3IF71"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF71"
FT                   /protein_id="CAI85208.1"
FT                   /translation="MLNILITRPQGKGAALAQQLEQAGYQASLFPVLKIEYLTPDSIEL
FT                   SPLTNADKIIFVSQDAVLALSELKPDINIKAQFYGVGQQTADTIYEVFGVRAAVPKQHD
FT                   SEGLLALKSLADVDSCNIVLVKGIGGRPDIAKTLKQRGAFLNNCVVYQRTPIDPEPNNW
FT                   IDHWQSQNVHGIVITSNAAVDAIFKNLAAPQRQWLQQCRFYVASERIGAYLQQHQVSSA
FT                   NIHIAAGASDNAMFTCINQQGSKMSEQSVPSTVDKAAQKTTNATANNGKATAKSDTLKA
FT                   TDKADNTKQRVSKVGSLALIISLIVASGVGFEFYQKLNASKTQSLAVNQLNEQNKLLQQ
FT                   ELQALKLAQANLQQTLLTSEQKVTAAMRESTTKNQQELKAALQQAQQQGSSLNPQEVTS
FT                   LQRMAEFKLWAENDYQGTSAVLKRLDALLSDHPGTITVRQAITQDIQTLDAIKPIAVEA
FT                   IYLQLSSVLKNIDELVFNAVNLPEEVAKIDDKVLSEDLSDWQQNLKNSWDQFLDGFITI
FT                   RHREGVAIEPLLSEQQRHLVNQRVKLYITQAQDALLSKHASVYFAALSEAKRLVAEYFK
FT                   QDDDVTKMVLKSLSNLEKEQLNFNPKVNLQSTQQVKEWAK"
     MLNILITRPQ GKGAALAQQL EQAGYQASLF PVLKIEYLTP DSIELSPLTN ADKIIFVSQD        60
     AVLALSELKP DINIKAQFYG VGQQTADTIY EVFGVRAAVP KQHDSEGLLA LKSLADVDSC       120
     NIVLVKGIGG RPDIAKTLKQ RGAFLNNCVV YQRTPIDPEP NNWIDHWQSQ NVHGIVITSN       180
     AAVDAIFKNL AAPQRQWLQQ CRFYVASERI GAYLQQHQVS SANIHIAAGA SDNAMFTCIN       240
     QQGSKMSEQS VPSTVDKAAQ KTTNATANNG KATAKSDTLK ATDKADNTKQ RVSKVGSLAL       300
     IISLIVASGV GFEFYQKLNA SKTQSLAVNQ LNEQNKLLQQ ELQALKLAQA NLQQTLLTSE       360
     QKVTAAMRES TTKNQQELKA ALQQAQQQGS SLNPQEVTSL QRMAEFKLWA ENDYQGTSAV       420
     LKRLDALLSD HPGTITVRQA ITQDIQTLDA IKPIAVEAIY LQLSSVLKNI DELVFNAVNL       480
     PEEVAKIDDK VLSEDLSDWQ QNLKNSWDQF LDGFITIRHR EGVAIEPLLS EQQRHLVNQR       540
     VKLYITQAQD ALLSKHASVY FAALSEAKRL VAEYFKQDDD VTKMVLKSLS NLEKEQLNFN       600
     PKVNLQSTQQ VKEWAK                                                       616
//

If you have problems or comments...

PBIL Back to PBIL home page