(data stored in ACNUC7421 zone)

EMBL: CR954246.HEMF

CR954246.HEMF        Location/Qualifiers
FT   CDS             31394..32368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="PSHAa0029"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /function="2.5.12 : Heme, porphyrin, and cobalamin"
FT                   /EC_number="1.3.3.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8349542, 10485293, 12975365; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85143"
FT                   /db_xref="GOA:Q3IDI8"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDI8"
FT                   /protein_id="CAI85143.1"
FT                   /translation="MAKYLEVNMQSKLLEQVKAYFMALQDTISQGLEAADGKAKFIEDN
FT                   WQRSEGGGGRTRVITNGNIIEQGGVNYSHVFGASMPASATAHRPELAGRSFHACGVSLV
FT                   IHPKNPHIPTSHANVRFFIAEKEGEQPIWWFGGGFDLTPFYPVLDDVVHWHQVAHDLCA
FT                   PFGDELYPKYKTWCDEYFYLKHRDETRGVGGLFFDDLNELGFEQSFAFTQAVGNGFLEA
FT                   YLPIIERRKKDEYTAQQRDFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPL
FT                   ARWEYNYTPNAESAEAKLYQYYLRPQQWLSTQPNDLIARECQL"
     MAKYLEVNMQ SKLLEQVKAY FMALQDTISQ GLEAADGKAK FIEDNWQRSE GGGGRTRVIT        60
     NGNIIEQGGV NYSHVFGASM PASATAHRPE LAGRSFHACG VSLVIHPKNP HIPTSHANVR       120
     FFIAEKEGEQ PIWWFGGGFD LTPFYPVLDD VVHWHQVAHD LCAPFGDELY PKYKTWCDEY       180
     FYLKHRDETR GVGGLFFDDL NELGFEQSFA FTQAVGNGFL EAYLPIIERR KKDEYTAQQR       240
     DFQLYRRGRY VEFNLVWDRG TLFGLQTGGR TESILMSMPP LARWEYNYTP NAESAEAKLY       300
     QYYLRPQQWL STQPNDLIAR ECQL                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page