(data stored in ACNUC7421 zone)

EMBL: CR954246.HEMY

CR954246.HEMY        Location/Qualifiers
FT   CDS             102066..103172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemY"
FT                   /locus_tag="PSHAa0100"
FT                   /product="putative HemY (Uncharacterized enzyme of heme
FT                   biosynthesis); by synteny may be involved in heme
FT                   biosynthesis or transport"
FT                   /function="5.2 : From other organisms"
FT                   /function="2.5.12 : Heme, porphyrin, and cobalamin"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 12864856"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85209"
FT                   /db_xref="GOA:Q3IF70"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF70"
FT                   /protein_id="CAI85209.1"
FT                   /translation="MIGLIILIIALVVVLAAAPFLLDEKGYVLISFNNTTIEGTIVSFA
FT                   VLTIAVLVVSYLTYKLVRYLFSIYRNTKHSFFARSQGRKQAAIEQALWSVINDDYAQIE
FT                   QALSSKVPDQYQDIRLALLAKAALANNQTDKALEYLFDINPEQQLKVAKLWLASGNSSA
FT                   IESQLRVIAESKKATALELKIYTEVLVQQQHFSALEAFLPRLLRKKVLTNEQWHRVFNA
FT                   YFASFPVDEVTAKYKQLPKKLHSYAYSAYLTQMAAAGQLSVIENDLIKMVKHEEQHAQL
FT                   ANILSKATTANARKLQTSIQDRLKKDEQNNSLLLALACLANAQGDYDLAARVFDKALNN
FT                   ENKKQYMQQAKLSYEKSAQLDKALVLYK"
     MIGLIILIIA LVVVLAAAPF LLDEKGYVLI SFNNTTIEGT IVSFAVLTIA VLVVSYLTYK        60
     LVRYLFSIYR NTKHSFFARS QGRKQAAIEQ ALWSVINDDY AQIEQALSSK VPDQYQDIRL       120
     ALLAKAALAN NQTDKALEYL FDINPEQQLK VAKLWLASGN SSAIESQLRV IAESKKATAL       180
     ELKIYTEVLV QQQHFSALEA FLPRLLRKKV LTNEQWHRVF NAYFASFPVD EVTAKYKQLP       240
     KKLHSYAYSA YLTQMAAAGQ LSVIENDLIK MVKHEEQHAQ LANILSKATT ANARKLQTSI       300
     QDRLKKDEQN NSLLLALACL ANAQGDYDLA ARVFDKALNN ENKKQYMQQA KLSYEKSAQL       360
     DKALVLYK                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page