(data stored in ACNUC7421 zone)

EMBL: CR954246.HFLC

CR954246.HFLC        Location/Qualifiers
FT   CDS             287934..288812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="PSHAa0274"
FT                   /product="HflC; HflKC is a membrane-associated complex"
FT                   /function="4.4 : Phage-related functions"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /function="1.6.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8947034, 9159109, 9636708, 9792691; Product type r :
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85373"
FT                   /db_xref="GOA:Q3IEZ4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEZ4"
FT                   /protein_id="CAI85373.1"
FT                   /translation="MKNFSLVILLAAIVMSFSSVFVVPEGQKAIVLLFSKVQKDSDDQA
FT                   IVYSPGLQFKVPFFSQVRRIDARIQTLDGTPDRFVTSEKKDLIVDSFVKWRVNDFSAFY
FT                   LRARGDKQYAETLLEQKVNNGLRTNFGTRTIREIVSGERSELMEEALVQASESARELGI
FT                   EVLDVRVKQINLPQEVSSSIYQRMRAERTAVAKEHRSEGQEKAETIRAGVDRRVTVMLA
FT                   DAERNSRTVRGQGDADAAAIYANAYNKDPEFFSFVRSLEAYKQTFKNKQDVMVLSPDSD
FT                   FFKYMKGATAQ"
     MKNFSLVILL AAIVMSFSSV FVVPEGQKAI VLLFSKVQKD SDDQAIVYSP GLQFKVPFFS        60
     QVRRIDARIQ TLDGTPDRFV TSEKKDLIVD SFVKWRVNDF SAFYLRARGD KQYAETLLEQ       120
     KVNNGLRTNF GTRTIREIVS GERSELMEEA LVQASESARE LGIEVLDVRV KQINLPQEVS       180
     SSIYQRMRAE RTAVAKEHRS EGQEKAETIR AGVDRRVTVM LADAERNSRT VRGQGDADAA       240
     AIYANAYNKD PEFFSFVRSL EAYKQTFKNK QDVMVLSPDS DFFKYMKGAT AQ               292
//

If you have problems or comments...

PBIL Back to PBIL home page