(data stored in ACNUC7421 zone)

EMBL: CR954246.HFLK

CR954246.HFLK        Location/Qualifiers
FT   CDS             286759..287928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="PSHAa0273"
FT                   /product="HflK complex with HflC"
FT                   /function="1.6.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /function="1.7 : Cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8947034, 9159109, 9636708, 9792691; Product type r :
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85372"
FT                   /db_xref="GOA:Q3IEZ5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEZ5"
FT                   /protein_id="CAI85372.1"
FT                   /translation="MAWNEPGNNGNDKDPWNNKGGRDQGPPDLDEVLRKFSNKFSGLFG
FT                   GKKPGNGSGGGLGGAGISFILIIAVIVWALSGIYTVKEAERGVVLQFGKYDRIADPGLR
FT                   WKMTFIETIIPVDIEAVRSLSTSGFMLTEDENVVSVEFQVQYRVIDPYLYKFSVTNADS
FT                   SLEEALESALRYVVGHAKMDQVLTNGREVVRQNTWDELNKVIEPYNLGLIVTDVNFKDS
FT                   RPPAEVKDAFDDAIAAQEDEERFIREAEAYAREIEPRARGQVTRMTQEAEGYQERITLE
FT                   AQGEVARFEKLLPEYQAAKTVTRERLYIDAMQEVLGNSSKVLVDVKGGNNMMYLPLDKI
FT                   MEKQGTATRVALPSSSDIQDLRNKVNTSRNSSVNSGSDRFNNDRFNDGR"
     MAWNEPGNNG NDKDPWNNKG GRDQGPPDLD EVLRKFSNKF SGLFGGKKPG NGSGGGLGGA        60
     GISFILIIAV IVWALSGIYT VKEAERGVVL QFGKYDRIAD PGLRWKMTFI ETIIPVDIEA       120
     VRSLSTSGFM LTEDENVVSV EFQVQYRVID PYLYKFSVTN ADSSLEEALE SALRYVVGHA       180
     KMDQVLTNGR EVVRQNTWDE LNKVIEPYNL GLIVTDVNFK DSRPPAEVKD AFDDAIAAQE       240
     DEERFIREAE AYAREIEPRA RGQVTRMTQE AEGYQERITL EAQGEVARFE KLLPEYQAAK       300
     TVTRERLYID AMQEVLGNSS KVLVDVKGGN NMMYLPLDKI MEKQGTATRV ALPSSSDIQD       360
     LRNKVNTSRN SSVNSGSDRF NNDRFNDGR                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page