(data stored in ACNUC7421 zone)

EMBL: CR954246.HFLX

CR954246.HFLX        Location/Qualifiers
FT   CDS             285368..286657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="PSHAa0272"
FT                   /product="HflX, putative GTPase subunit of protease with
FT                   nucleoside triP hydrolase domain"
FT                   /function="1.6.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /function="4.4 : Phage-related functions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8248183, 7748952; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85371"
FT                   /db_xref="GOA:Q3IEY9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEY9"
FT                   /protein_id="CAI85371.1"
FT                   /translation="MFDRYKSGEQAVLVHIDFPKEGDREDLHELELLVSSAGVSSLAVV
FT                   QGSRQAPHPKLFVGTGKAEEIAETVKIHNADVVIFNHQLRPSQERNLERILQCRVLDRT
FT                   TLILDIFAQRARTHEGKLQVELAQLRHMSTRLIRGWTHLERQKGGVGLRGPGETQLETD
FT                   RRLLRARLQNIRARLDKVAVQREQGRRARSRNEIPTVSLVGYTNAGKSTLFNRITNSDV
FT                   YAADQLFATLDPTLRKLELGDVGPVILADTVGFIRHLPHDLVAAFKATLTETREADLQL
FT                   HVIDVADARLKENIEQVQSVLKEIEADEVPQLLVYNKIDALDDITARIDRDDEGQPIRV
FT                   WLSAQTGEGCELLSEAISELLAKQMLSETLLLAPQYGRLRSSLFSLSAVSDERFDEQGN
FT                   WLLDVRLPVVEWNRLIKEFGPEIAGFIVCD"
     MFDRYKSGEQ AVLVHIDFPK EGDREDLHEL ELLVSSAGVS SLAVVQGSRQ APHPKLFVGT        60
     GKAEEIAETV KIHNADVVIF NHQLRPSQER NLERILQCRV LDRTTLILDI FAQRARTHEG       120
     KLQVELAQLR HMSTRLIRGW THLERQKGGV GLRGPGETQL ETDRRLLRAR LQNIRARLDK       180
     VAVQREQGRR ARSRNEIPTV SLVGYTNAGK STLFNRITNS DVYAADQLFA TLDPTLRKLE       240
     LGDVGPVILA DTVGFIRHLP HDLVAAFKAT LTETREADLQ LHVIDVADAR LKENIEQVQS       300
     VLKEIEADEV PQLLVYNKID ALDDITARID RDDEGQPIRV WLSAQTGEGC ELLSEAISEL       360
     LAKQMLSETL LLAPQYGRLR SSLFSLSAVS DERFDEQGNW LLDVRLPVVE WNRLIKEFGP       420
     EIAGFIVCD                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page