(data stored in ACNUC7421 zone)

EMBL: CR954246.HFQ

CR954246.HFQ         Location/Qualifiers
FT   CDS             285088..285351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hfq"
FT                   /locus_tag="PSHAa0271"
FT                   /product="Host factor-I; polyA binding protein"
FT                   /function="3.2.2 : Processing and degradation of RNA"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12634847, 12834354, 12853626, 14561880, 7748952; Product
FT                   type mc : molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85370"
FT                   /db_xref="GOA:Q3IDT7"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDT7"
FT                   /protein_id="CAI85370.1"
FT                   /translation="MAKGQSLQDPFLNALRRERIPVSIFLVNGIKLQGKIQSFDQFVIL
FT                   LENTVNQMVYKHAISTVVPARAVNFQGVQENDDTEEPEAGNI"
     MAKGQSLQDP FLNALRRERI PVSIFLVNGI KLQGKIQSFD QFVILLENTV NQMVYKHAIS        60
     TVVPARAVNF QGVQENDDTE EPEAGNI                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page