(data stored in ACNUC7421 zone)

EMBL: CR954246.HSLO

CR954246.HSLO        Location/Qualifiers
FT   CDS             complement(243346..244191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="PSHAa0229"
FT                   /product="heat shock protein 33, redox regulated chaperone"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /function="3.3.7 : Protein folding"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10025400; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85332"
FT                   /db_xref="GOA:Q3ILP2"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILP2"
FT                   /protein_id="CAI85332.1"
FT                   /translation="MQQDLLHRYLFDNLDVRGELVQIENAYNEMIANHNYPDAVKALLG
FT                   ELLVATCLLTATLKFEGEIAVQLQGDGPVKYAVINGDDKQNMRGIARLQSEVTGSTVKE
FT                   LIGQGYMVITITPTKGERYQGIVPLEHETLSECIEAYFEQSEQLKTRLWFATDTTEGNA
FT                   KACGLFLQVLPVDKQKSIEDFAHLEALSHTIKDEELLELDANTVLTRLYHEDNPRVFEP
FT                   QSIQFKCGCTREKTMTALVNIGQQALLDDVAEHGEIKISCHYCLKDYLFDEQDVKNIFN
FT                   "
     MQQDLLHRYL FDNLDVRGEL VQIENAYNEM IANHNYPDAV KALLGELLVA TCLLTATLKF        60
     EGEIAVQLQG DGPVKYAVIN GDDKQNMRGI ARLQSEVTGS TVKELIGQGY MVITITPTKG       120
     ERYQGIVPLE HETLSECIEA YFEQSEQLKT RLWFATDTTE GNAKACGLFL QVLPVDKQKS       180
     IEDFAHLEAL SHTIKDEELL ELDANTVLTR LYHEDNPRVF EPQSIQFKCG CTREKTMTAL       240
     VNIGQQALLD DVAEHGEIKI SCHYCLKDYL FDEQDVKNIF N                           281
//

If you have problems or comments...

PBIL Back to PBIL home page