(data stored in ACNUC7421 zone)

EMBL: CR954246.HSLR

CR954246.HSLR        Location/Qualifiers
FT   CDS             complement(244204..244626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslR"
FT                   /locus_tag="PSHAa0230"
FT                   /product="heat shock protein 15, DNA/RNA-binding"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10675343, 9867837; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85333"
FT                   /db_xref="GOA:Q3ILP1"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILP1"
FT                   /protein_id="CAI85333.1"
FT                   /translation="MAKKSNANPNLEHKDELKIRLDKWLWAARFYKTRAAAREMVQGGK
FT                   VHYNGQRTKAGKIVEIGATIKLAQGVDEKIVTVLKILEKRQSAPIAQTLYQESDASIAK
FT                   REENSIARKNNSLFAPHPDKKPDKKQRRELLKLKLS"
     MAKKSNANPN LEHKDELKIR LDKWLWAARF YKTRAAAREM VQGGKVHYNG QRTKAGKIVE        60
     IGATIKLAQG VDEKIVTVLK ILEKRQSAPI AQTLYQESDA SIAKREENSI ARKNNSLFAP       120
     HPDKKPDKKQ RRELLKLKLS                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page