(data stored in ACNUC7421 zone)

EMBL: CR954246.KAMA

CR954246.KAMA        Location/Qualifiers
FT   CDS             complement(490999..491925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kamA"
FT                   /locus_tag="PSHAa0473"
FT                   /product="putative lysine 2,3 aminomutase"
FT                   /function="2.2.3.2 : Degradation of aminoacids"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 11222759, 11578923, 10839984, 14532061;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85570"
FT                   /db_xref="GOA:Q3IFP6"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFP6"
FT                   /protein_id="CAI85570.1"
FT                   /translation="MVGLSSQVHDNDIKARSLFPVRVPIPFIKKMRKGDANDPLLLQVM
FT                   PRHQEFLTKSGFNKDPLLEQSNQQPGLLHKYKSRVLVMFKTGCAVNCRYCFRRHFPYQE
FT                   NQLNKRSLLDALSYIKSDNNINEVILSGGDPLMAKDDAISWFLDELEQLPQIKRMRIHT
FT                   RLPVVIPARITDELCERLARSPLKIVFVNHINHANEIDDDFKAAMQKLKQVGVVLFNQA
FT                   VILKDVNDTTAAQVNLSEALFDADVLPYYLHLLDKVEGASHFDISEEQAIKIMAELLEA
FT                   LPGFLVPKLVREIGGEKSKTPIDLKLI"
     MVGLSSQVHD NDIKARSLFP VRVPIPFIKK MRKGDANDPL LLQVMPRHQE FLTKSGFNKD        60
     PLLEQSNQQP GLLHKYKSRV LVMFKTGCAV NCRYCFRRHF PYQENQLNKR SLLDALSYIK       120
     SDNNINEVIL SGGDPLMAKD DAISWFLDEL EQLPQIKRMR IHTRLPVVIP ARITDELCER       180
     LARSPLKIVF VNHINHANEI DDDFKAAMQK LKQVGVVLFN QAVILKDVND TTAAQVNLSE       240
     ALFDADVLPY YLHLLDKVEG ASHFDISEEQ AIKIMAELLE ALPGFLVPKL VREIGGEKSK       300
     TPIDLKLI                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page