(data stored in ACNUC7421 zone)

EMBL: CR954246.LPD

CR954246.LPD         Location/Qualifiers
FT   CDS             409248..410675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpd"
FT                   /locus_tag="PSHAa0393"
FT                   /product="dihydrolipoamide dehydrogenase,
FT                   FAD/NAD(P)-binding, component of the 2-oxoglutarate
FT                   dehydrogenase and the pyruvate dehydrogenase complexes"
FT                   /function="2.1 : Metabolism of carbohydrates and related
FT                   molecules"
FT                   /EC_number="1.8.1.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6352260; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85491"
FT                   /db_xref="GOA:Q3IIH6"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH6"
FT                   /protein_id="CAI85491.1"
FT                   /translation="MSNELKTQVVVLGGGPGGYSAAFRAADLGLEVTLVESRDTLGGVC
FT                   LNVGCIPSKALLHVAKVIDDAAAMADHGVTFGAPQIDLDKIRSWKDSVIGQLTGGLTSM
FT                   SKMRKVKVVYGYGKFTGSNTIAVEGTDGTTTITFDNAIIAAGSKPVSLPFIPEDDRVID
FT                   STGALELKDIPEKLLVLGGGIIGLEMGTVYRALGSAIDVVEFADQLVPAADKDIVKIYQ
FT                   KYVSDKFNVMLSTKVTGIDAKDDGLYVTFEGKNAPAEPVRYDKVLVAVGRTPNGKLLDA
FT                   DKAGVNVDDRGFINVDKQLKTNVEHIFAVGDIVGQPMLAHKAVHEAHVAAEVISGQKHY
FT                   FDPKCIPSIAYTDPEMAWVGVTEKEAKEQGLSIETAVFPWAASGRAIASARTEGSTKLI
FT                   FDKESGRVIGGAMVGINAGEMLGEIGLAVEMGADGEDLALTIHAHPTLNESIGLAAEIY
FT                   EGSITDLPNKKAVKKKK"
     MSNELKTQVV VLGGGPGGYS AAFRAADLGL EVTLVESRDT LGGVCLNVGC IPSKALLHVA        60
     KVIDDAAAMA DHGVTFGAPQ IDLDKIRSWK DSVIGQLTGG LTSMSKMRKV KVVYGYGKFT       120
     GSNTIAVEGT DGTTTITFDN AIIAAGSKPV SLPFIPEDDR VIDSTGALEL KDIPEKLLVL       180
     GGGIIGLEMG TVYRALGSAI DVVEFADQLV PAADKDIVKI YQKYVSDKFN VMLSTKVTGI       240
     DAKDDGLYVT FEGKNAPAEP VRYDKVLVAV GRTPNGKLLD ADKAGVNVDD RGFINVDKQL       300
     KTNVEHIFAV GDIVGQPMLA HKAVHEAHVA AEVISGQKHY FDPKCIPSIA YTDPEMAWVG       360
     VTEKEAKEQG LSIETAVFPW AASGRAIASA RTEGSTKLIF DKESGRVIGG AMVGINAGEM       420
     LGEIGLAVEM GADGEDLALT IHAHPTLNES IGLAAEIYEG SITDLPNKKA VKKKK            475
//

If you have problems or comments...

PBIL Back to PBIL home page