(data stored in ACNUC7421 zone)

EMBL: CR954246.LYSA

CR954246.LYSA        Location/Qualifiers
FT   CDS             complement(95744..96997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="PSHAa0093"
FT                   /product="putative diaminopimelate decarboxylase"
FT                   /function="2.2.1.2 : Aspartate family"
FT                   /EC_number="4.1.1.20"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 10625645; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85202"
FT                   /db_xref="GOA:Q3IEW2"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEW2"
FT                   /protein_id="CAI85202.1"
FT                   /translation="MDFFNYKNNQLFAEDVSIASIAQQYGTPCYVYSRATFERHYLAFA
FT                   NATKNHKSLVCYAVKANSNIAVLNILARLGSGFDIVSKGELARVIKAGGDASKVVFSGV
FT                   AKTADEIAYALKLGIKCFNVESVSELERISEVACELNLAAPISIRVNPDIDAKTHPYIS
FT                   TGLKENKFGIDIQTAVSVYQHAASLPGLNIIGVDCHIGSQLTETRPFLEALDKLLTLID
FT                   ELKACNIELTHLDIGGGLGVTYNDEQPPHPSEYAAQVTERLVNYRHLELIFEPGRAIAA
FT                   NAGVLVTQVEFIKQNQDKYFAIVDAGMNDMLRPALYQAWQKIIPVSVRDDETPTHNFDI
FT                   VGPVCETGDFLGKDRELALKQGDLLVQRSAGAYGFTMSSNYNSRPRVAEIMVDGSQHHL
FT                   IRERETIESLYQGEKILP"
     MDFFNYKNNQ LFAEDVSIAS IAQQYGTPCY VYSRATFERH YLAFANATKN HKSLVCYAVK        60
     ANSNIAVLNI LARLGSGFDI VSKGELARVI KAGGDASKVV FSGVAKTADE IAYALKLGIK       120
     CFNVESVSEL ERISEVACEL NLAAPISIRV NPDIDAKTHP YISTGLKENK FGIDIQTAVS       180
     VYQHAASLPG LNIIGVDCHI GSQLTETRPF LEALDKLLTL IDELKACNIE LTHLDIGGGL       240
     GVTYNDEQPP HPSEYAAQVT ERLVNYRHLE LIFEPGRAIA ANAGVLVTQV EFIKQNQDKY       300
     FAIVDAGMND MLRPALYQAW QKIIPVSVRD DETPTHNFDI VGPVCETGDF LGKDRELALK       360
     QGDLLVQRSA GAYGFTMSSN YNSRPRVAEI MVDGSQHHLI RERETIESLY QGEKILP          417
//

If you have problems or comments...

PBIL Back to PBIL home page