(data stored in ACNUC7421 zone)

EMBL: CR954246.LYSC

CR954246.LYSC        Location/Qualifiers
FT   CDS             549431..550648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysC"
FT                   /locus_tag="PSHAa0533"
FT                   /product="Aspartokinase"
FT                   /function="2.2.1.2 : Aspartate family"
FT                   /EC_number="2.7.2.4"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85622"
FT                   /db_xref="GOA:Q3ILF2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILF2"
FT                   /protein_id="CAI85622.1"
FT                   /translation="MALIVQKFGGTSVGSIERIEAVADLVVKTKQQGHQVVVVLSAMSG
FT                   ETNRLINLAKQIDTRPSSRELDVLISTGEQVSVALLAMAIIKRGHSAVSLLADQVNILT
FT                   DNMFGKARITDVAATRLKHELEHNRIAIIAGFQGRDIEGNVTTLGRGGTDTSAVEIAGA
FT                   IKADECQIYTDVNGVYTTDPRVEPNARRMSQVTFAEMLELASLGAKVLHIRSVEAAGKH
FT                   NVPLRVLSSFYPDAGTLISFEESDMPGNVVSGIAFNRDECLINVEGVLSGTQYLAKILK
FT                   LFADNGIEIDMINQVNHNVDKVDYAFTVHTNDYLHALDVLTEQQAQLTAQNIFGLTTVA
FT                   KVSAVGMGMKSHSGVASLFFDALAAENINVILVSTSEIKISVLIDEKYLELAVRALHKI
FT                   FLTENE"
     MALIVQKFGG TSVGSIERIE AVADLVVKTK QQGHQVVVVL SAMSGETNRL INLAKQIDTR        60
     PSSRELDVLI STGEQVSVAL LAMAIIKRGH SAVSLLADQV NILTDNMFGK ARITDVAATR       120
     LKHELEHNRI AIIAGFQGRD IEGNVTTLGR GGTDTSAVEI AGAIKADECQ IYTDVNGVYT       180
     TDPRVEPNAR RMSQVTFAEM LELASLGAKV LHIRSVEAAG KHNVPLRVLS SFYPDAGTLI       240
     SFEESDMPGN VVSGIAFNRD ECLINVEGVL SGTQYLAKIL KLFADNGIEI DMINQVNHNV       300
     DKVDYAFTVH TNDYLHALDV LTEQQAQLTA QNIFGLTTVA KVSAVGMGMK SHSGVASLFF       360
     DALAAENINV ILVSTSEIKI SVLIDEKYLE LAVRALHKIF LTENE                       405
//

If you have problems or comments...

PBIL Back to PBIL home page