(data stored in ACNUC7421 zone)

EMBL: CR954246.LYSS

CR954246.LYSS        Location/Qualifiers
FT   CDS             532684..534219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="PSHAa0518"
FT                   /product="lysyl-tRNA synthetase"
FT                   /function="3.3.2 : Aminoacyl-tRNA synthetases"
FT                   /EC_number="6.1.1.6"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7678344, 7961513, 12142429; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85608"
FT                   /db_xref="GOA:Q3ILD7"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILD7"
FT                   /protein_id="CAI85608.1"
FT                   /translation="MTDQIQDENKLIAERRGKLDAIRQNCPANGHPNQFRREHYTADLQ
FT                   AQFGDKSKEELVELQQVVSIAGRILAKRGPFFVIQDMKGRVQSYASKDVQKDLKEKYGQ
FT                   LDTGDIIGVKGALNKSGKGDLYVEMTEYQLLTKSLRPLPEKFHGLSDQETKYRQRYVDL
FT                   ITNEATRETFRIRSQVVEGIRRFLADRDFMEVETPMLQVIPGGASARPFVTHHNALDID
FT                   MYLRIAPELYLKRLVVGGFDRVFEINRNFRNEGLSTRHNPEFTMIEFYQAYADYIDLMN
FT                   ITEDMLRTVAENVLGSAVVVNTTKDENGEVIDSVEYDFGQPFTRLSMSDAILKYNPEFD
FT                   AAVFNDPENHFEQLKAYAKQVHVKIPENCVWGPGKFLCEIFEETAEHMLIQPTFITGYP
FT                   WEVSPLARRNDENSFVTDRFEFFVGGRELANGFSELNDAQDQAERFTRQVEEKDAGDDE
FT                   AMHYDEDYIRALEYGLPPTAGEGIGIDRLVMLFTDSPTIKDVILFPHMRPQAD"
     MTDQIQDENK LIAERRGKLD AIRQNCPANG HPNQFRREHY TADLQAQFGD KSKEELVELQ        60
     QVVSIAGRIL AKRGPFFVIQ DMKGRVQSYA SKDVQKDLKE KYGQLDTGDI IGVKGALNKS       120
     GKGDLYVEMT EYQLLTKSLR PLPEKFHGLS DQETKYRQRY VDLITNEATR ETFRIRSQVV       180
     EGIRRFLADR DFMEVETPML QVIPGGASAR PFVTHHNALD IDMYLRIAPE LYLKRLVVGG       240
     FDRVFEINRN FRNEGLSTRH NPEFTMIEFY QAYADYIDLM NITEDMLRTV AENVLGSAVV       300
     VNTTKDENGE VIDSVEYDFG QPFTRLSMSD AILKYNPEFD AAVFNDPENH FEQLKAYAKQ       360
     VHVKIPENCV WGPGKFLCEI FEETAEHMLI QPTFITGYPW EVSPLARRND ENSFVTDRFE       420
     FFVGGRELAN GFSELNDAQD QAERFTRQVE EKDAGDDEAM HYDEDYIRAL EYGLPPTAGE       480
     GIGIDRLVML FTDSPTIKDV ILFPHMRPQA D                                      511
//

If you have problems or comments...

PBIL Back to PBIL home page