(data stored in ACNUC7421 zone)

EMBL: CR954246.MIAA

CR954246.MIAA        Location/Qualifiers
FT   CDS             284086..285006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="PSHAa0270"
FT                   /product="delta(2)-isopentenylpyrophosphate tRNA-adenosine
FT                   transferase"
FT                   /function="3.2.3.1 : tRNA modifications"
FT                   /EC_number="2.5.1.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9148919, 10692168, 11160115; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85369"
FT                   /db_xref="GOA:Q3IDT9"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDT9"
FT                   /protein_id="CAI85369.1"
FT                   /translation="MLSNLPVIFLMGPTAAGKTALAISLCEHLNTEIISVDSALVYKGM
FT                   DIGTAKPDASELARAPHHLIDLLDPSETYSVADFRRDAIIKIDEFHQQGKVPVLVGGTM
FT                   LYFKALIDGLSPLPEANVEIRAELEAQAAQYGWPHLYQELVKIDPQAAQKMSENDSQRI
FT                   NRALEVYKLTGKTMTELQKQKQPVLPYTFHQFAIAPTQRSELHQRIEKRFKIMLEQGFE
FT                   NEVSTLYLRKDLHPNMPSIRCVGYRQMWDYLAGEIDHDEMVFRGIAATRQLAKRQLTWL
FT                   RSWPDVTWLTTGDEENLHRVVSSLS"
     MLSNLPVIFL MGPTAAGKTA LAISLCEHLN TEIISVDSAL VYKGMDIGTA KPDASELARA        60
     PHHLIDLLDP SETYSVADFR RDAIIKIDEF HQQGKVPVLV GGTMLYFKAL IDGLSPLPEA       120
     NVEIRAELEA QAAQYGWPHL YQELVKIDPQ AAQKMSENDS QRINRALEVY KLTGKTMTEL       180
     QKQKQPVLPY TFHQFAIAPT QRSELHQRIE KRFKIMLEQG FENEVSTLYL RKDLHPNMPS       240
     IRCVGYRQMW DYLAGEIDHD EMVFRGIAAT RQLAKRQLTW LRSWPDVTWL TTGDEENLHR       300
     VVSSLS                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page