(data stored in ACNUC7421 zone)

EMBL: CR954246.MLTD

CR954246.MLTD        Location/Qualifiers
FT   CDS             complement(306586..308055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltD"
FT                   /locus_tag="PSHAa0293"
FT                   /product="putative membrane-bound lytic murein
FT                   transglycosylase D [Precursor]"
FT                   /function="1.1.1 : Biosynthesis of murein sacculus and
FT                   peptidoglycan"
FT                   /EC_number="3.2.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 10843862, 1663890; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85392"
FT                   /db_xref="GOA:Q3IEX5"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEX5"
FT                   /protein_id="CAI85392.1"
FT                   /translation="MRSLVLACLGVFLFGCETTKPEPIEAPQIFTHFKPSYSAPSELKT
FT                   PQSTKTNLRITPPKNTKNKIITPPAKTTDLWQHIANNLHFPIEQNKALKKRINWYLQQP
FT                   DYLQVMSKRAAPYLYHIVKKVEQQQLPIELALLPFVESGFRPTAHSSQQAVGVWQLVGA
FT                   TAHHFGVKSDQWYDGRQDVLAATDAALAYLSYLYKRFDGNWLHALAAYNSGEGRVKRAI
FT                   KQNKKHGKSTDYWSLKLPQETADYVPKLLALSYLVKHPQQGFKRPKLAYKALTTHMNVG
FT                   QQFDFSIIAKLSGVGSKQLHALNQGYLKNQSSPNGPHTLLLPIEQQALLNSSFFKTNFA
FT                   GEYIVKQNDTLYSIARRFGMPLSTLKQLNNKQNNLIGIGEKLLVGQPKTLPESLTIDYK
FT                   ISPYLEHQEVVIATLEIDYEVQPGDTLWSISQLYNVPHSDLAKWNKLSASSMLKPGIQL
FT                   VLFIPQAEKPQVTTIKKDLLLDLQKTLNQPR"
     MRSLVLACLG VFLFGCETTK PEPIEAPQIF THFKPSYSAP SELKTPQSTK TNLRITPPKN        60
     TKNKIITPPA KTTDLWQHIA NNLHFPIEQN KALKKRINWY LQQPDYLQVM SKRAAPYLYH       120
     IVKKVEQQQL PIELALLPFV ESGFRPTAHS SQQAVGVWQL VGATAHHFGV KSDQWYDGRQ       180
     DVLAATDAAL AYLSYLYKRF DGNWLHALAA YNSGEGRVKR AIKQNKKHGK STDYWSLKLP       240
     QETADYVPKL LALSYLVKHP QQGFKRPKLA YKALTTHMNV GQQFDFSIIA KLSGVGSKQL       300
     HALNQGYLKN QSSPNGPHTL LLPIEQQALL NSSFFKTNFA GEYIVKQNDT LYSIARRFGM       360
     PLSTLKQLNN KQNNLIGIGE KLLVGQPKTL PESLTIDYKI SPYLEHQEVV IATLEIDYEV       420
     QPGDTLWSIS QLYNVPHSDL AKWNKLSASS MLKPGIQLVL FIPQAEKPQV TTIKKDLLLD       480
     LQKTLNQPR                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page