(data stored in ACNUC7421 zone)

EMBL: CR954246.MSCS

CR954246.MSCS        Location/Qualifiers
FT   CDS             414580..415398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscS"
FT                   /locus_tag="PSHAa0396"
FT                   /product="putative mechanosensitive channel protein (MscS
FT                   family)"
FT                   /function="1.3.2 : Mechanosensors"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 14671322, 15063854, 12767977; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85494"
FT                   /db_xref="GOA:Q3IIH3"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH3"
FT                   /protein_id="CAI85494.1"
FT                   /translation="MESVLNWLNENSGLILHYGIQAVIALVIFLLGGRIAKFCANLTEK
FT                   AFDKKKVDKAVGSFVSSIVFAIVFMATVLMALSQIGIETTSFIAILGAAGLAVGLALQG
FT                   SLSNFASGVLIILLRPFKSGDYVEAGNKAGTIKKIEIFSTELRTPDNKVIIMPNSKIMS
FT                   DAIVNYSRESTRRIDLVIRVDYDADLRKAKEVLKSILDSESRILKDPAYNVSVSELAES
FT                   SVNFIVRPWVESADYWPTYWSLLEEIKIIFDEQGINIPAPQMDVHLRKQD"
     MESVLNWLNE NSGLILHYGI QAVIALVIFL LGGRIAKFCA NLTEKAFDKK KVDKAVGSFV        60
     SSIVFAIVFM ATVLMALSQI GIETTSFIAI LGAAGLAVGL ALQGSLSNFA SGVLIILLRP       120
     FKSGDYVEAG NKAGTIKKIE IFSTELRTPD NKVIIMPNSK IMSDAIVNYS RESTRRIDLV       180
     IRVDYDADLR KAKEVLKSIL DSESRILKDP AYNVSVSELA ESSVNFIVRP WVESADYWPT       240
     YWSLLEEIKI IFDEQGINIP APQMDVHLRK QD                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page