(data stored in ACNUC7421 zone)

EMBL: CR954246.MTNN

CR954246.MTNN        Location/Qualifiers
FT   CDS             complement(561359..562066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnN"
FT                   /locus_tag="PSHAa0547"
FT                   /product="5'-methylthioadenosine/S-adenosylhomocysteine
FT                   nucleosidase; MtnN"
FT                   /function="2.3.3 : Sugar-nucleotide biosynthesis and
FT                   conversions"
FT                   /EC_number="3.2.2.16"
FT                   /EC_number="3.2.2.9"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85635"
FT                   /db_xref="GOA:Q3ILJ7"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILJ7"
FT                   /protein_id="CAI85635.1"
FT                   /translation="MNVGIIGAMEPEVKILREAMQNPQTLTKAGFTFYTGELAGNTVTL
FT                   VQSGIGKVASTIATTLLIDNFAPDCVINTGSAGGFDPSLNVGDVVISSEVRHHDVDVTA
FT                   FGYEIGQVPQMPAGFAAHPKLVAAAEQTIAQISDVKTLVGLICTGDIFMCDPIRIEKAR
FT                   SDFPTMLAVEMEGASIAQTCHTLNTPFVVIRSMSDIAGKESPQSFEEYLETASINSSKM
FT                   VVALLEKLTAVSL"
     MNVGIIGAME PEVKILREAM QNPQTLTKAG FTFYTGELAG NTVTLVQSGI GKVASTIATT        60
     LLIDNFAPDC VINTGSAGGF DPSLNVGDVV ISSEVRHHDV DVTAFGYEIG QVPQMPAGFA       120
     AHPKLVAAAE QTIAQISDVK TLVGLICTGD IFMCDPIRIE KARSDFPTML AVEMEGASIA       180
     QTCHTLNTPF VVIRSMSDIA GKESPQSFEE YLETASINSS KMVVALLEKL TAVSL            235
//

If you have problems or comments...

PBIL Back to PBIL home page