(data stored in ACNUC7421 zone)

EMBL: CR954246.MURI

CR954246.MURI        Location/Qualifiers
FT   CDS             264077..264874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /locus_tag="PSHAa0252"
FT                   /product="glutamate racemase"
FT                   /function="1.1.1 : Biosynthesis of murein sacculus and
FT                   peptidoglycan"
FT                   /EC_number="5.1.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8098327; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85355"
FT                   /db_xref="GOA:Q3IDS7"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDS7"
FT                   /protein_id="CAI85355.1"
FT                   /translation="MSAHIMVFDSGIGGTTVLEHIQQSIPDAQYSYFMDNALLPYGAQS
FT                   QQTIINRLCALIHFINQQALNVDLIVIACNTASTSALGAVRQITTIPIVGVVPAIKPAA
FT                   QLTQSKHIGLLATPATISSPYTRTLIQEHTNNIAVSLYSSVELVTLAERLFFEQSLDTT
FT                   KLHQELDRLNIDQSIDVLVLGCTHFPILAEPISQYFNRKVQLLDSGAAIAKRVHYLISQ
FT                   LNLTNNNIADTKKPLQYYATASVSSKLAVKLVTLIDPAQNEER"
     MSAHIMVFDS GIGGTTVLEH IQQSIPDAQY SYFMDNALLP YGAQSQQTII NRLCALIHFI        60
     NQQALNVDLI VIACNTASTS ALGAVRQITT IPIVGVVPAI KPAAQLTQSK HIGLLATPAT       120
     ISSPYTRTLI QEHTNNIAVS LYSSVELVTL AERLFFEQSL DTTKLHQELD RLNIDQSIDV       180
     LVLGCTHFPI LAEPISQYFN RKVQLLDSGA AIAKRVHYLI SQLNLTNNNI ADTKKPLQYY       240
     ATASVSSKLA VKLVTLIDPA QNEER                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page