(data stored in ACNUC7421 zone)

EMBL: CR954246.MUTL

CR954246.MUTL        Location/Qualifiers
FT   CDS             282222..284078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="PSHAa0269"
FT                   /product="Enzyme in GATC methyl-directed mismatch repair,
FT                   stimulates binding of Vsr and MutS to heteroduplex DNA"
FT                   /function="3.1.4 : DNA proof-reading and repair"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12887908; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85368"
FT                   /db_xref="GOA:Q3IDU0"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDU0"
FT                   /protein_id="CAI85368.1"
FT                   /translation="MSIEILPARLANQIAAGEVVERPASVVKELVENSLDAGATRIQID
FT                   IERGGHKLIRIRDNGAGIAQDELTLALSRHATSKLKSLDDLENICSLGFRGEALASISS
FT                   VSRLTLSSKTKHQEAAWQAFAQGRDMAVQVKPVAHPDGTTIEVKDLFFNTPARRKFLRT
FT                   EKTEFSHIDELIKRIALSRFDVSITLTHNEKVVRQYRAKTDPSQAIARVAQVAGKAFAE
FT                   QGLHIQSGEGGLQLHGWVLPVGSANTVQYTYVNNRMMRDKLILHAIRQAFEEVSGAQEL
FT                   PGFVIYIDIDPRQVDVNVHPAKHEVRFHQGRLVHDFILQAIKQVVVPLQGEFTNEPLNN
FT                   LADTAFSQTDTARSPTGNFESGEVFDYPKSQLQPSHSVSSGGASLGSRSAGGSGGAYRA
FT                   TPSTNHHDINAFYQGVSEQHAAHFDQGAHVSVGVNQSHAVEQAVALKTVAIISINEGVC
FT                   VFSSEQQLYCSHFKYALVDDWHEQIKEQGSLEGKALLLPVRVNLSKQDCELIAAQQSWF
FT                   TLLGFELIIEKQFVMVKKLPACLYLLDVTSAVESLLEACKAPLENIESWLAWQMQHTPA
FT                   RFYSSNIFLAQQARMQNNPQTIERLRVKAVKIDIEHYLMQLD"
     MSIEILPARL ANQIAAGEVV ERPASVVKEL VENSLDAGAT RIQIDIERGG HKLIRIRDNG        60
     AGIAQDELTL ALSRHATSKL KSLDDLENIC SLGFRGEALA SISSVSRLTL SSKTKHQEAA       120
     WQAFAQGRDM AVQVKPVAHP DGTTIEVKDL FFNTPARRKF LRTEKTEFSH IDELIKRIAL       180
     SRFDVSITLT HNEKVVRQYR AKTDPSQAIA RVAQVAGKAF AEQGLHIQSG EGGLQLHGWV       240
     LPVGSANTVQ YTYVNNRMMR DKLILHAIRQ AFEEVSGAQE LPGFVIYIDI DPRQVDVNVH       300
     PAKHEVRFHQ GRLVHDFILQ AIKQVVVPLQ GEFTNEPLNN LADTAFSQTD TARSPTGNFE       360
     SGEVFDYPKS QLQPSHSVSS GGASLGSRSA GGSGGAYRAT PSTNHHDINA FYQGVSEQHA       420
     AHFDQGAHVS VGVNQSHAVE QAVALKTVAI ISINEGVCVF SSEQQLYCSH FKYALVDDWH       480
     EQIKEQGSLE GKALLLPVRV NLSKQDCELI AAQQSWFTLL GFELIIEKQF VMVKKLPACL       540
     YLLDVTSAVE SLLEACKAPL ENIESWLAWQ MQHTPARFYS SNIFLAQQAR MQNNPQTIER       600
     LRVKAVKIDI EHYLMQLD                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page