(data stored in ACNUC7421 zone)

EMBL: CR954246.MUTM

CR954246.MUTM        Location/Qualifiers
FT   CDS             467259..468035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="PSHAa0447"
FT                   /product="formamidopyrimidine DNA glycosylase"
FT                   /function="3.1.4 : DNA proof-reading and repair"
FT                   /EC_number="3.2.2.23"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 3053667; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85544"
FT                   /db_xref="GOA:Q3IEI2"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEI2"
FT                   /protein_id="CAI85544.1"
FT                   /translation="MGITPHVLNQVVTKVNIHNGSMRWPVPDDVYQLTGLTVTGVERRA
FT                   KYLLLHCALGSTILHLGMSGNLRVVSANEPLKKHDHIEFIFANGKALRLNDPRRFGCCL
FT                   WQAPGSVHKLLAKLGPEPLTDEFFAKQVYQQSRNKKVPVKQFIMNNAIVVGVGNIYANE
FT                   SLFKAGIDPRREAGKVSLKSFEALIPIIKDTLAAAITQGGTTLKDFAQSDGKPGYFAQQ
FT                   LLVYGRKGQPCLVCKSELQEVRLGQRSTVFCGKCQK"
     MGITPHVLNQ VVTKVNIHNG SMRWPVPDDV YQLTGLTVTG VERRAKYLLL HCALGSTILH        60
     LGMSGNLRVV SANEPLKKHD HIEFIFANGK ALRLNDPRRF GCCLWQAPGS VHKLLAKLGP       120
     EPLTDEFFAK QVYQQSRNKK VPVKQFIMNN AIVVGVGNIY ANESLFKAGI DPRREAGKVS       180
     LKSFEALIPI IKDTLAAAIT QGGTTLKDFA QSDGKPGYFA QQLLVYGRKG QPCLVCKSEL       240
     QEVRLGQRST VFCGKCQK                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page