(data stored in ACNUC7421 zone)

EMBL: CR954246.MUTY

CR954246.MUTY        Location/Qualifiers
FT   CDS             569838..570896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="PSHAa0554"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /function="3.1.4 : DNA proof-reading and repair"
FT                   /EC_number="3.2.2.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2197596, 2001994; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85642"
FT                   /db_xref="GOA:Q3ILJ0"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILJ0"
FT                   /protein_id="CAI85642.1"
FT                   /translation="MDLNKQQSDWFSNQVVDWYHLHGRKTLPWQLAKTPYKVWVSEVML
FT                   QQTQVVTVIPYFERFMQSFPDIIALANADEDQVLHHWTGLGYYARARNLHKTAKIVRDK
FT                   YQGQFPTTLEEVIDLPGIGRSTAGAVLSLSLGQHHPILDGNVKRVLARFFMVEGWYGVK
FT                   KVESQLWHLSEQLTPKNNVTEFNQAMMDLGSSLCSRSRFDCPACPLSSRCGAFKTQQVK
FT                   TFPHSKPKKAVPKKSCHQLIIKHDDKVLMEKRPNSGIWGGLFGFFEFNELSELEVFIAQ
FT                   QGLTADLVALEPFTHIFSHFELTINPHVLNIVQIPDVINDRQLVWYPLAQSIEVGLAAP
FT                   TKKLVKQIAPIG"
     MDLNKQQSDW FSNQVVDWYH LHGRKTLPWQ LAKTPYKVWV SEVMLQQTQV VTVIPYFERF        60
     MQSFPDIIAL ANADEDQVLH HWTGLGYYAR ARNLHKTAKI VRDKYQGQFP TTLEEVIDLP       120
     GIGRSTAGAV LSLSLGQHHP ILDGNVKRVL ARFFMVEGWY GVKKVESQLW HLSEQLTPKN       180
     NVTEFNQAMM DLGSSLCSRS RFDCPACPLS SRCGAFKTQQ VKTFPHSKPK KAVPKKSCHQ       240
     LIIKHDDKVL MEKRPNSGIW GGLFGFFEFN ELSELEVFIA QQGLTADLVA LEPFTHIFSH       300
     FELTINPHVL NIVQIPDVIN DRQLVWYPLA QSIEVGLAAP TKKLVKQIAP IG               352
//

If you have problems or comments...

PBIL Back to PBIL home page