(data stored in ACNUC7421 zone)

EMBL: CR954246.NADC

CR954246.NADC        Location/Qualifiers
FT   CDS             complement(400100..400945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="PSHAa0386"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8561507; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85484"
FT                   /db_xref="GOA:Q3III3"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:Q3III3"
FT                   /protein_id="CAI85484.1"
FT                   /translation="MPIPHTLVSQLVTLALGEDLNYQSAENGDITAQLIPVNEQANAKV
FT                   ITREDCIFCGKDLIIEVFKQVDPSVVVNVLVNDGDAVKANSTLFTATGSARAILTAERT
FT                   ALNFVQTLSGTATTTAHYVKELAGTKTQLLDTRKTIPGLRILQKYAVKCGGGANHRIGL
FT                   YDAFLIKENHIAACGGINKAVAQAKQNQPNKPIEVEVESLVDLKQALDAGADIIMLDNF
FT                   NVEQIKQAVVVTNKRAKLEVSGNMTLQTLKTYSQAGVDFISSGALTKNLQSIDLSMRFD
FT                   "
     MPIPHTLVSQ LVTLALGEDL NYQSAENGDI TAQLIPVNEQ ANAKVITRED CIFCGKDLII        60
     EVFKQVDPSV VVNVLVNDGD AVKANSTLFT ATGSARAILT AERTALNFVQ TLSGTATTTA       120
     HYVKELAGTK TQLLDTRKTI PGLRILQKYA VKCGGGANHR IGLYDAFLIK ENHIAACGGI       180
     NKAVAQAKQN QPNKPIEVEV ESLVDLKQAL DAGADIIMLD NFNVEQIKQA VVVTNKRAKL       240
     EVSGNMTLQT LKTYSQAGVD FISSGALTKN LQSIDLSMRF D                           281
//

If you have problems or comments...

PBIL Back to PBIL home page